KEGG   Homo sapiens (human): 7264Help
Entry
7264              CDS       T01001                                 

Gene name
TSTA3, FX, P35B, SDR4E1
Definition
(RefSeq) tissue specific transplantation antigen P35B
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    7264 (TSTA3)
   00520 Amino sugar and nucleotide sugar metabolism
    7264 (TSTA3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     7264 (TSTA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NICE-3 NAD_binding_4
Motif
Other DBs
NCBI-GeneID: 7264
NCBI-ProteinID: NP_003304
OMIM: 137020
HGNC: 12390
Ensembl: ENSG00000104522
Vega: OTTHUMG00000165159
Pharos: Q13630(Tbio)
UniProt: Q13630 A0A140VKC8
Structure
PDB: 

Position
8q24.3
AA seq 321 aa AA seqDB search
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEK
VQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPD
KTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNF
NIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPI
ILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTP
FKQAVKETCAWFTDNYEQARK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaccccagggatccatgcggattctagtgacagggggctctgggctggtaggc
aaagccatccagaaggtggtagcagatggagctggacttcctggagaggactgggtgttt
gtctcctctaaagacgccgatctcacggatacagcacagacccgcgccctgtttgagaag
gtccaacccacacacgtcatccatcttgctgcaatggtggggggcctgttccggaatatc
aaatacaatttggacttctggaggaaaaacgtgcacatgaacgacaacgtcctgcactcg
gcctttgaggtgggcgcccgcaaggtggtgtcctgcctgtccacctgtatcttccctgac
aagacgacctacccgatagatgagaccatgatccacaatgggcctccccacaacagcaat
tttgggtactcgtatgccaagaggatgatcgacgtgcagaacagggcctacttccagcag
tacggctgcaccttcaccgctgtcatccccaccaacgtcttcgggccccacgacaacttc
aacatcgaggatggccacgtgctgcctggcctcatccacaaggtgcacctggccaagagc
agcggctcggccctgacggtgtggggtacagggaatccgcggaggcagttcatatactcg
ctggacctggcccagctctttatctgggtcctgcgggagtacaatgaagtggagcccatc
atcctctccgtgggcgaggaagatgaggtctccatcaaggaggcagccgaggcggtggtg
gaggccatggacttccatggggaagtcacctttgatacaaccaagtcggatgggcagttt
aagaagacagccagtaacagcaagctgaggacctacctgcccgacttccggttcacaccc
ttcaagcaggcggtgaaggagacctgtgcttggttcactgacaactacgagcaggcccgg
aagtga

DBGET integrated database retrieval system