KEGG   Homo sapiens (human): 7266Help
Entry
7266              CDS       T01001                                 

Gene name
DNAJC7, DJ11, DJC7, TPR2, TTC2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C7
  KO
K09527  DnaJ homolog subfamily C member 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7266 (DNAJC7)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   7266 (DNAJC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 DnaJ TPR_8 TPR_11 TPR_16 TPR_12 TPR_17 TPR_19 TPR_14 TPR_9 TPR_7 ANAPC3 TPR_6 TPR_10 NFACT-R_1 RPT DUF5588 RPN7
Motif
Other DBs
NCBI-GeneID: 7266
NCBI-ProteinID: NP_003306
OMIM: 601964
HGNC: 12392
Ensembl: ENSG00000168259
Vega: OTTHUMG00000180862
Pharos: Q99615(Tbio)
UniProt: Q99615
Position
17q21.2
AA seq 494 aa AA seqDB search
MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccgcggagtgcgatgtggtaatggcggcgaccgagccggagctgctcgac
gaccaagaggcgaagagggaagcagagactttcaaggaacaaggaaatgcatactatgcc
aagaaagattacaatgaagcttataattattatacaaaagccatagatatgtgtcctaaa
aatgctagctattatggtaatcgagcagccaccttgatgatgcttggaaggttccgggaa
gctcttggagatgcacaacagtcagtgaggttggatgacagttttgtccggggacatcta
cgagagggcaagtgccacctctctctggggaatgccatggcagcatgtcgcagcttccag
agagccctagaactggatcataaaaatgctcaggcacaacaagagttcaagaatgctaat
gcagtcatggaatatgagaaaatagcagaaacagattttgagaagcgagattttcggaag
gttgttttctgcatggaccgtgccctagaatttgcccctgcctgccatcgcttcaaaatc
ctcaaggcagaatgtttagcaatgctgggtcgttatccagaagcacagtctgtggctagt
gacattctacgaatggattccaccaatgcagatgctctgtatgtacgaggtctttgcctt
tattacgaagattgtattgagaaggcagttcagtttttcgtacaggctctcaggatggct
cctgaccacgagaaggcctgcattgcctgcagaaatgccaaagcactcaaagcaaagaaa
gaagatgggaataaagcatttaaggaaggaaattacaaactagcatatgaactgtacaca
gaagccctggggatagaccccaacaatataaaaacaaatgctaaactctactgtaatcgg
ggtacggttaattccaagcttaggaaactagatgatgcaatagaagactgcacaaatgca
gtgaagcttgatgacacttacataaaagcctacttgagaagagctcagtgttacatggac
acagaacagtatgaagaagcagtacgagactatgaaaaagtataccagacagagaaaaca
aaagaacacaaacagctcctaaaaaatgcgcagctggaactgaagaagagtaagaggaaa
gattactacaagattctaggagtggacaagaatgcctctgaggacgagatcaagaaagct
tatcggaaacgggccttgatgcaccatccagatcggcatagtggagccagtgctgaggtt
cagaaggaggaggagaagaagttcaaggaagttggagaggcctttactatcctctctgat
cccaagaaaaagactcgctatgacagtggacaggacctagatgaggagggcatgaatatg
ggtgattttgatccaaacaatatcttcaaggcattctttggcggtcctggcggcttcagc
tttgaagcatctggtccagggaatttcttttttcaatttggctaa

DBGET integrated database retrieval system