KEGG   Homo sapiens (human): 7267
Entry
7267              CDS       T01001                                 
Symbol
TTC3, DCRR1, RNF105, TPRDIII
Name
(RefSeq) tetratricopeptide repeat domain 3
  KO
K15712  E3 ubiquitin-protein ligase TTC3 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7267 (TTC3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7267 (TTC3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    7267 (TTC3)
SSDB
Motif
Pfam: TTC3_DZIP3_dom zf-RING_2 TPR_1 TPR_2 zf-C3HC4_2 zf-C3HC4 zf-rbx1 TPR_16 zf-RING_5 TPR_12 TPR_11 zf-C3HC4_3 zf-RING_UBOX zf-RING_11 ANAPC3 TPR_17 TPR_9
Other DBs
NCBI-GeneID: 7267
NCBI-ProteinID: NP_001001894
OMIM: 602259
HGNC: 12393
Ensembl: ENSG00000182670
Pharos: P53804(Tbio)
UniProt: P53804
Position
21:37073254..37203118
AA seq 2025 aa
MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSER
NLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEI
NLKKLQHLELMEDIVDLAKKVANDSFLIGGLLRIGCKIENKILAMEEALNWIKYAGDVTI
LTKLGSIDNCWPMLSIFFTEYKYHITKIVMEDCNLLEELKTQSCMDCIEEGELMKMKGNE
EFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFLRTGQFRNALGDGKRATILKNTWPK
GHYRYCDALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQIEDLQGRTANK
DPIKAFYENRAYTPRSLSAPIFTTSLNFVEKERDFRKINHEMANGGNQNLKVADEALKVD
DCDCHPEFSPPSSQPPKHKGKQKSRNNESEKFSSSSPLTLPADLKNILEKQFSKSSRAAH
QDFANIMKMLRSLIQDGYMALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVY
GLAISLLGIGQPEELSEAENQFKRIIEHYPSEGLDCLAYCGIGKVYLKKNRFLEALNHFE
KARTLIYRLPGVLTWPTSNVIIEESQPQKIKMLLEKFVEECKFPPVPDAICCYQKCHGYS
KIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEG
VISKIIIFSSGGEVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKKLKRKIQKKEA
KKLAQERMEEDLRESNPPKNEEQKETVDNVQRCQFLDDRILQCIKQYADKIKSGIQNTAM
LLKELLSWKVLSTEDYTTCFSSRNFLNEAVDYVIRHLIQENNRVKTRIFLHVLSELKEVE
PKLAAWIQKLNSFGLDATGTFFSRYGASLKLLDFSIMTFLWNEKYGHKLDSIEGKQLDYF
SEPASLKEARCLIWLLEEHRDKFPALHSALDEFFDIMDSRCTVLRKQDSGEAPFSSTKVK
NKSKKKKPKDSKPMLVGSGTTSVTSNNEIITSSEDHSNRNSDSAGPFAVPDHLRQDVEEF
EALYDQHSNEYVVRNKKLWDMNPKQKCSTLYDYFSQFLEEHGPLDMSNKMFSAEYEFFPE
ETRQILEKAGGLKPFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTKVEEISKAGEY
VRVKLQLNPAAREFKPDVKSKPVSDSSSAPAFENVKPKPVSANSPKPACEDVKAKPVSDN
SSRQVSEDGQPKGVSSNSPKPGSEDANYKRVSCNSPKPVLEDVKPTYWAQSHLVTGYCTY
LPFQRFDITQTPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPSFVANDRADKN
AAAYFEGHHLNAENVAGHQIASETQILEGSLGISVKSHCSTGDAHTVLSESNRNDEHCGN
SNNKCEVIPESTSAVTNIPHVQMVAIQVSWNIIHQEVNTEPYNPFEERQGEISRIEKEHQ
VLQDQLQEVYENYEQIKLKGLEETRDLEEKLKRHLEENKISKTELDWFLQDLEREIKKWQ
QEKKEIQERLKSLKKKIKKVSNASEMYTQKNDGKEKEHELHLDQSLEISNTLTNEKMKIE
EYIKKGKEDYEESHQRAVAAEVSVLENWKESEVYKLQIMESQAEAFLKKLGLISRDPAAY
PDMESDIRSWELFLSNVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQISELSFPACNTV
HPELLPESSGDDGQGLVTSASDVTGNHAALHRDPSVFSAGDSPGEAPSALLPGPPPGQPE
ATQLTGPKRAGQAALSERSPVADRKQPVPPGRAARSSQSPKKPFNSIIEHLSVVFPCYNS
TELAGFIKKVRSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDKRTYEPSSATPV
TRSSQGSPSVVVAPSPKTKGQKAEDVPVRIALGASSCEICHEVFKSKNVRVLKCGHKYHK
GCFKQWLKGQSACPACQGRDLLTEESPSGRGWPSQNQELPSCSSR
NT seq 6078 nt   +upstreamnt  +downstreamnt
atggacaattttgctgagggagatttcactgtggcggattatgccttgttagaagattgc
cctcacgtggatgattgtgtctttgctgctgaatttatgagcaatgattatgttcgtgtg
actcagctttactgtgatggggtgggtgtgcaatataaagattatatccaaagtgagagg
aatttggaatttgacatctgcagtatatggtgtagtaaaccaatttctgtcctgcaagat
tattgcgatgccattaaaataaacatcttctggccacttctgtttcaacatcaaaacagt
tccgtaatatcacgattgcatccctgtgtggacgccaacaattcacgtgcttctgagata
aatttgaagaaactacaacatcttgagttgatggaagatattgtggatttggcaaagaaa
gttgctaatgattcattccttattggaggcttattgagaattggttgtaaaatagaaaat
aaaatcttggcaatggaagaagctctgaattggataaaatatgcaggcgatgtaacaatt
ctaactaaattaggatcaattgacaattgttggcctatgttaagtattttctttactgaa
tacaagtaccacataactaaaattgtaatggaagactgcaatttgcttgaagaacttaaa
actcaaagttgtatggattgtatagaggaaggagaactaatgaaaatgaaaggaaatgaa
gagttttccaaagaaagatttgatatagctattatctattacaccagagccattgaatat
agacctgaaaactaccttctttatggtaaccgagctctttgttttcttcgtactggacag
tttagaaatgcactcggtgatggaaagagagccactattctgaagaacacttggccaaag
ggtcattatcgttattgtgatgctctttctatgctgggggaatatgactgggccctgcaa
gcaaacataaaagctcaaaaactctgtaaaaatgaccctgagggaatcaaggatctaatt
cagcagcatgtaaagttacaaaaacaaatagaagacctacaaggtcgaacagcaaataag
gatccaattaaagccttttatgaaaacagggcctacacacctaggagtttatcagcacct
atatttactacttcacttaactttgtggagaaggaaagagatttcagaaaaattaatcac
gaaatggccaacggtggtaatcagaatctaaaggtggcggatgaggcgttgaaggtagat
gattgtgactgtcatcctgaattttcaccaccatcaagtcagcctccaaaacataaagga
aaacaaaaatctcgaaacaatgaatcagaaaagttcagttctagttcaccattgacttta
ccagcagatttgaagaacatcttggagaaacagttttctaaatcttccagagctgcacac
caggattttgctaatataatgaaaatgctgagaagcttaattcaagatggctatatggcc
ttattggagcagcgttgccgcagcgctgcacaggcctttacagagttgctgaacggttta
gatcctcaaaaaataaagcaattgaacctggccatgattaactatgttttggtcgtctat
ggacttgccatttctctccttggaataggacagcctgaggaattatctgaagccgaaaac
cagtttaagaggattattgaacactaccccagtgagggccttgattgcttggcctactgt
ggaattggaaaagtatatttgaaaaaaaacagatttctagaagctctcaatcactttgag
aaagcaagaaccttgatttatcgtcttcctggagtgttaacttggcccacgagtaatgtg
attattgaagagtctcagccacaaaaaataaagatgctgttagagaaatttgttgaagaa
tgcaagttccctccagtgccagatgccatttgttgctatcagaagtgccatggatattct
aagatccagatatacataactgatccagactttaagggttttatacgcatcagctgttgc
cagtactgtaaaatagaatttcacatgaattgctggaagaagttaaaaactacaaccttt
aatgataaaattgacaaggattttctacaaggaatatgtcttacccctgactgtgaaggt
gtcatttctaagattatcatcttcagcagtggtggtgaagttaaatgtgaatttgaacac
aaggtcataaaagaaaaggttcctccaagacctattctgaaacagaaatgttctagccta
gagaaactaagactgaaagaagacaaaaaattgaagagaaagatccaaaaaaaagaagca
aaaaagttagcacaagaaagaatggaggaggacttaagagaaagtaatccacccaaaaat
gaagagcagaaagaaactgtagacaatgttcagcgttgtcagttccttgatgacagaatt
ctacagtgtataaagcagtatgctgacaagattaaatccggcatacagaatacagccatg
cttctcaaagaattgctttcttggaaagttttgagcacagaagactatacaacctgtttt
tctagcagaaattttctaaatgaagcagtggactatgttattcgccacttgattcaagaa
aataacagagtaaagacaagaatatttctgcatgttttgagtgagcttaaagaagtggag
cccaaattagccgcctggatccaaaaacttaatagctttggcttagatgccacaggaact
ttcttttctcgttatggagcatctcttaaactgcttgattttagtatcatgactttcctc
tggaatgagaaatatggtcacaaactagactctatagaaggaaagcaacttgattatttc
tctgagccagcatcattgaaggaagcccgttgtttaatatggctgctagaagaacacaga
gacaagttcccagcattgcatagtgctttagatgaattctttgatataatggacagccgc
tgtactgtgttaaggaaacaagatagtggtgaagcaccgtttagttcaaccaaggtgaaa
aacaaaagcaagaaaaagaagccaaaggattcaaagcctatgttagttgggtctggaaca
acttcagtaacttcaaataatgagatcatcacttcaagtgaagaccatagcaatcgaaat
tcagattctgcaggcccatttgcagtgcctgaccatcttcggcaagatgtagaagaattc
gaagctctctatgaccaacacagtaacgaatatgttgtccgcaataagaagctatgggac
atgaacccaaaacaaaaatgttcaactctatatgattacttctctcagtttttggaggaa
catggtcccttggacatgagtaacaagatgttctctgcagaatatgagtttttcccagaa
gaaactcgacagatactagaaaaagcaggaggtttaaaaccttttctcttgggatgccct
cgttttgttgtgattgacaactgtattgcactgaagaaggttgcatcacggctcaagaaa
aaaaggaagaagaaaaacattaaaacaaaagtagaagaaatttcaaaagcaggggagtat
gtacgagttaaactacaactgaatccagctgctagggaatttaaaccagatgtaaagtct
aaaccagtgtcagattcatcttcagcaccagcttttgaaaatgtgaaacccaaacctgtg
tctgcaaattctcccaagccagcttgtgaagatgtgaaggccaaaccagtatccgacaat
tcttctagacaagtttctgaggatgggcaacccaaaggggtctcttctaattctcctaaa
ccaggctctgaggatgcaaattacaagcgagtctcctgtaattcccccaaaccggttctt
gaggatgtgaaaccaacttattgggctcaatcccatttggtcacaggatactgtacgtat
cttcctttccagagatttgatatcacccagacaccgccagcatacataaacgtgttacca
ggtttgccccagtacaccagcatatatacacccttggccagcctttctcctgaatatcag
ctaccaagatcagtaccagtggtgccgtcttttgtagccaatgacagagcagataaaaat
gctgctgcctattttgagggtcatcatttgaatgctgagaatgttgctggtcaccagatt
gcctctgaaacacagatccttgagggctctttgggaatatctgtaaagtcacactgcagc
acaggtgatgctcatacagtcctgagtgagtctaacagaaatgatgagcactgtggaaat
tctaacaacaaatgtgaagtaattccagaaagcaccagtgcagtaacaaacattccacac
gtgcagatggttgccatacaggtatcttggaacataatacaccaagaagtcaatactgag
ccatataatccttttgaggaacgacaaggggaaatttcacggattgaaaaggagcaccaa
gtattacaagaccaacttcaagaagtgtatgaaaattatgagcagataaaacttaagggc
ttagaagagaccagggacctggaagagaagttgaaaaggcacttagaagaaaacaagatc
tcaaagacggaattagattggttccttcaagatttggaaagagaaattaaaaaatggcaa
caggaaaaaaaagaaatccaagaaagactaaaatcactgaagaagaaaattaaaaaggtt
tcaaatgccagtgaaatgtatacccagaaaaatgatggaaaggaaaaggaacatgaatta
catctggatcagtcccttgaaatcagcaacacacttacaaatgagaaaatgaaaatagaa
gagtatataaagaaagggaaagaggattatgaagagagtcatcagagagctgtggctgca
gaggtatccgtacttgaaaactggaaggagagtgaagtgtataagctacagatcatggag
tcacaagcagaagcctttctgaagaagctggggctgattagccgtgatcctgcagcatat
cctgacatggagtctgatatacgttcatgggaattgtttctttctaatgttacaaaagaa
attgagaaagcaaagtctcagtttgaagaacaaattaaggcaattaaaaatggttctcgg
ctcagtgaactttctaaagtgcagatttctgagctttcatttcctgcctgtaacacggtt
catcccgagttactccctgagtcttcaggcgacgatggccaagggcttgtgacttctgca
agcgacgtgactggaaaccacgcagcacttcacagggatcctagtgtgttctctgctggt
gattccccaggggaggctccttctgcgctgttgccagggccaccccctggtcagcctgaa
gccactcagctgacagggccaaaacgggctggccaggcagctctgtcagaacgaagccct
gtggctgatcggaagcagcctgttcctccaggacgtgctgcgcgttcaagccagtctcca
aaaaagccgttcaatagtattattgagcacctgtcagtggtattcccatgttacaacagc
actgagcttgctggttttattaaaaaagtgcgaagcaaaaacaagaactcactctcagga
ttgagtattgatgaaattgtccaaagagtgacagaacacattctagatgaacagaaaaag
aaaaagccaaacccaggaaaggacaagaggacttatgagcccagctctgccacccccgtg
accaggtcctcccagggctcaccctcggtggttgttgcaccatcacccaaaaccaagggg
cagaaagcagaagatgtccctgtgaggattgcactgggtgcaagttcctgtgaaatatgc
cacgaggtgttcaaatcaaaaaacgtgcgtgtgctcaaatgtgggcacaagtatcacaaa
gggtgctttaagcagtggcttaaagggcagagcgcttgcccggcctgccagggtcgtgat
ctcctgacagaagagtcaccttctggaagaggctggcccagtcagaatcaggagctgcct
tcctgctcttctaggtag

DBGET integrated database retrieval system