KEGG   Homo sapiens (human): 7268Help
Entry
7268              CDS       T01001                                 

Gene name
TTC4, CNS1
Definition
(RefSeq) tetratricopeptide repeat domain 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_16 ANAPC3 DUF357 NinG
Motif
Other DBs
NCBI-GeneID: 7268
NCBI-ProteinID: NP_004614
OMIM: 606753
HGNC: 12394
Ensembl: ENSG00000243725
Vega: OTTHUMG00000009914
Pharos: O95801(Tdark)
UniProt: O95801
Structure
PDB: 

Position
1p32.3
AA seq 387 aa AA seqDB search
MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPD
LACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLY
TNRAAAQYYLGNFRSALNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQI
DAKEKKLLEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACED
EDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYAQSDFISAFHEDSRF
IDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKAL
TPAFLVCVGSSPFCKNFLRGRKVYQIR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacctgggcaggatcccacctcagacgacgtcatggactcgttcctggaaaag
ttccagagccagccttaccgtggcggctttcatgaggaccagtgggagaaggaatttgaa
aaggtccccctatttatgtcgagagcgccatcagaaattgatcccagggagaatcctgac
ttggcttgtctccagtcaattatttttgatgaggagcgttctccagaagaacaggccaag
acctataaagatgagggcaatgattactttaaagaaaaagactacaagaaagctgtaatt
tcatacactgaaggcttaaagaagaaatgtgcagatcctgatttgaatgctgtcctttat
accaaccgggcagcagcacagtactatctgggcaattttcgttctgctctcaatgatgtg
acagctgccagaaagctaaaaccctgccacctcaaagcaataataagaggtgccttatgc
catctggaactgaaacactttgccgaggccgtgaactggtgtgatgagggactgcaaata
gatgccaaagagaagaagcttctggaaatgagggctaaagcagacaagctgaagcgaatt
gaacagagggatgtgaggaaagccaacttgaaagaaaagaaggagaggaatcagaatgag
gctttactccaggccatcaaggctaggaatatcaggctctcagaagctgcctgtgaggat
gaagattcagcctcagaaggtctaggtgagcttttcctggatggactcagcactgagaac
ccccatggagccaggctgagtctagatggccagggcaggctgagctggcctgtgctcttt
ctgtacccagagtatgcccagtcggacttcatctctgcttttcatgaggactccaggttt
attgatcatctaatggtgatgtttggtgaaacaccctcttgggacctagagcaaaaatat
tgccctgataatttggaggtctactttgaggatgaggacagggcagaactataccgggtg
cctgccaagagcaccttgctacaggttctacagcaccagaggtactttgtaaaagccctg
acaccagcatttttggtctgtgtaggatcctctcctttttgcaagaattttctccggggg
agaaaggtgtaccagatacgatga

DBGET integrated database retrieval system