KEGG   Homo sapiens (human): 727Help
Entry
727               CDS       T01001                                 

Gene name
C5, C5D, C5a, C5b, CPAMD4, ECLZB
Definition
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05168  Herpes simplex infection
hsa05322  Systemic lupus erythematosus
Disease
H00103  Late complement pathway defects
Drug target
Eculizumab: D03940
Pexelizumab: D10023
Ravulizumab: D11054
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    727 (C5)
 09160 Human Diseases
  09162 Immune diseases
   05322 Systemic lupus erythematosus
    727 (C5)
  09163 Neurodegenerative diseases
   05020 Prion diseases
    727 (C5)
  09167 Infectious diseases
   05133 Pertussis
    727 (C5)
   05150 Staphylococcus aureus infection
    727 (C5)
   05168 Herpes simplex infection
    727 (C5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A2M_comp A2M_N_2 A2M NTR A2M_recep A2M_N ANATO DUF4369
Motif
Other DBs
NCBI-GeneID: 727
NCBI-ProteinID: NP_001726
OMIM: 120900
HGNC: 1331
Ensembl: ENSG00000106804
Vega: OTTHUMG00000020579
Pharos: P01031(Tclin)
UniProt: P01031
Structure
PDB: 

Position
9q33.2
AA seq 1676 aa AA seqDB search
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atgggccttttgggaatactttgttttttaatcttcctggggaaaacctggggacaggag
caaacatatgtcatttcagcaccaaaaatattccgtgttggagcatctgaaaatattgtg
attcaagtttatggatacactgaagcatttgatgcaacaatctctattaaaagttatcct
gataaaaaatttagttactcctcaggccatgttcatttatcctcagagaataaattccaa
aactctgcaatcttaacaatacaaccaaaacaattgcctggaggacaaaacccagtttct
tatgtgtatttggaagttgtatcaaagcatttttcaaaatcaaaaagaatgccaataacc
tatgacaatggatttctcttcattcatacagacaaacctgtttatactccagaccagtca
gtaaaagttagagtttattcgttgaatgacgacttgaagccagccaaaagagaaactgtc
ttaactttcatagatcctgaaggatcagaagttgacatggtagaagaaattgatcatatt
ggaattatctcttttcctgacttcaagattccgtctaatcctagatatggtatgtggacg
atcaaggctaaatataaagaggacttttcaacaactggaaccgcatattttgaagttaaa
gaatatgtcttgccacatttttctgtctcaatcgagccagaatataatttcattggttac
aagaactttaagaattttgaaattactataaaagcaagatatttttataataaagtagtc
actgaggctgacgtttatatcacatttggaataagagaagacttaaaagatgatcaaaaa
gaaatgatgcaaacagcaatgcaaaacacaatgttgataaatggaattgctcaagtcaca
tttgattctgaaacagcagtcaaagaactgtcatactacagtttagaagatttaaacaac
aagtacctttatattgctgtaacagtcatagagtctacaggtggattttctgaagaggca
gaaatacctggcatcaaatatgtcctctctccctacaaactgaatttggttgctactcct
cttttcctgaagcctgggattccatatcccatcaaggtgcaggttaaagattcgcttgac
cagttggtaggaggagtcccagtaacactgaatgcacaaacaattgatgtaaaccaagag
acatctgacttggatccaagcaaaagtgtaacacgtgttgatgatggagtagcttccttt
gtgcttaatctcccatctggagtgacggtgctggagtttaatgtcaaaactgatgctcca
gatcttccagaagaaaatcaggccagggaaggttaccgagcaatagcatactcatctctc
agccaaagttacctttatattgattggactgataaccataaggctttgctagtgggagaa
catctgaatattattgttacccccaaaagcccatatattgacaaaataactcactataat
tacttgattttatccaagggcaaaattatccactttggcacgagggagaaattttcagat
gcatcttatcaaagtataaacattccagtaacacagaacatggttccttcatcccgactt
ctggtctattacatcgtcacaggagaacagacagcagaattagtgtctgattcagtctgg
ttaaatattgaagaaaaatgtggcaaccagctccaggttcatctgtctcctgatgcagat
gcatattctccaggccaaactgtgtctcttaatatggcaactggaatggattcctgggtg
gcattagcagcagtggacagtgctgtgtatggagtccaaagaggagccaaaaagcccttg
gaaagagtatttcaattcttagagaagagtgatctgggctgtggggcaggtggtggcctc
aacaatgccaatgtgttccacctagctggacttaccttcctcactaatgcaaatgcagat
gactcccaagaaaatgatgaaccttgtaaagaaattctcaggccaagaagaacgctgcaa
aagaagatagaagaaatagctgctaaatataaacattcagtagtgaagaaatgttgttac
gatggagcctgcgttaataatgatgaaacctgtgagcagcgagctgcacggattagttta
gggccaagatgcatcaaagctttcactgaatgttgtgtcgtcgcaagccagctccgtgct
aatatctctcataaagacatgcaattgggaaggctacacatgaagaccctgttaccagta
agcaagccagaaattcggagttattttccagaaagctggttgtgggaagttcatcttgtt
cccagaagaaaacagttgcagtttgccctacctgattctctaaccacctgggaaattcaa
ggcgttggcatttcaaacactggtatatgtgttgctgatactgtcaaggcaaaggtgttc
aaagatgtcttcctggaaatgaatataccatattctgttgtacgaggagaacagatccaa
ttgaaaggaactgtttacaactataggacttctgggatgcagttctgtgttaaaatgtct
gctgtggagggaatctgcacttcggaaagcccagtcattgatcatcagggcacaaagtcc
tccaaatgtgtgcgccagaaagtagagggctcctccagtcacttggtgacattcactgtg
cttcctctggaaattggccttcacaacatcaatttttcactggagacttggtttggaaaa
gaaatcttagtaaaaacattacgagtggtgccagaaggtgtcaaaagggaaagctattct
ggtgttactttggatcctaggggtatttatggtaccattagcagacgaaaggagttccca
tacaggatacccttagatttggtccccaaaacagaaatcaaaaggattttgagtgtaaaa
ggactgcttgtaggtgagatcttgtctgcagttctaagtcaggaaggcatcaatatccta
acccacctccccaaagggagtgcagaggcggagctgatgagcgttgtcccagtattctat
gtttttcactacctggaaacaggaaatcattggaacatttttcattctgacccattaatt
gaaaagcagaaactgaagaaaaaattaaaagaagggatgttgagcattatgtcctacaga
aatgctgactactcttacagtgtgtggaagggtggaagtgctagcacttggttaacagct
tttgctttaagagtacttggacaagtaaataaatacgtagagcagaaccaaaattcaatt
tgtaattctttattgtggctagttgagaattatcaattagataatggatctttcaaggaa
aattcacagtatcaaccaataaaattacagggtaccttgcctgttgaagcccgagagaac
agcttatatcttacagcctttactgtgattggaattagaaaggctttcgatatatgcccc
ctggtgaaaatcgacacagctctaattaaagctgacaactttctgcttgaaaatacactg
ccagcccagagcacctttacattggccatttctgcgtatgctctttccctgggagataaa
actcacccacagtttcgttcaattgtttcagctttgaagagagaagctttggttaaaggt
aatccacccatttatcgtttttggaaagacaatcttcagcataaagacagctctgtacct
aacactggtacggcacgtatggtagaaacaactgcctatgctttactcaccagtctgaac
ttgaaagatataaattatgttaacccagtcatcaaatggctatcagaagagcagaggtat
ggaggtggcttttattcaacccaggacacaatcaatgccattgagggcctgacggaatat
tcactcctggttaaacaactccgcttgagtatggacatcgatgtttcttacaagcataaa
ggtgccttacataattataaaatgacagacaagaatttccttgggaggccagtagaggtg
cttctcaatgatgacctcattgtcagtacaggatttggcagtggcttggctacagtacat
gtaacaactgtagttcacaaaaccagtacctctgaggaagtttgcagcttttatttgaaa
atcgatactcaggatattgaagcatcccactacagaggctacggaaactctgattacaaa
cgcatagtagcatgtgccagctacaagcccagcagggaagaatcatcatctggatcctct
catgcggtgatggacatctccttgcctactggaatcagtgcaaatgaagaagacttaaaa
gcccttgtggaaggggtggatcaactattcactgattaccaaatcaaagatggacatgtt
attctgcaactgaattcgattccctccagtgatttcctttgtgtacgattccggatattt
gaactctttgaagttgggtttctcagtcctgccactttcacagtgtacgaataccacaga
ccagataaacagtgtaccatgttttatagcacttccaatatcaaaattcagaaagtctgt
gaaggagccgcgtgcaagtgtgtagaagctgattgtgggcaaatgcaggaagaattggat
ctgacaatctctgcagagacaagaaaacaaacagcatgtaaaccagagattgcatatgct
tataaagttagcatcacatccatcactgtagaaaatgtttttgtcaagtacaaggcaacc
cttctggatatctacaaaactggggaagctgttgctgagaaagactctgagattaccttc
attaaaaaggtaacctgtactaacgctgagctggtaaaaggaagacagtacttaattatg
ggtaaagaagccctccagataaaatacaatttcagtttcaggtacatctaccctttagat
tccttgacctggattgaatactggcctagagacacaacatgttcatcgtgtcaagcattt
ttagctaatttagatgaatttgccgaagatatctttttaaatggatgctaa

DBGET integrated database retrieval system