KEGG   Homo sapiens (human): 7275Help
Entry
7275              CDS       T01001                                 

Gene name
TUB, RDOB, rd5
Definition
(RefSeq) tubby bipartite transcription factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Tub Tub_N DUF3527
Motif
Other DBs
NCBI-GeneID: 7275
NCBI-ProteinID: NP_813977
OMIM: 601197
HGNC: 12406
Ensembl: ENSG00000166402
Vega: OTTHUMG00000165690
Pharos: P50607(Tbio)
UniProt: P50607
Structure
PDB: 

Position
11p15.4
AA seq 506 aa AA seqDB search
MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRR
ARQSEEQAPLVESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQG
GAARKEKKGKHKGTSGPAALAEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQD
LRATMQRKGISSSMSFDEDEEDEEENSSSSSQLNSNTRPSSATSRKSVREAASAPSPTAP
EQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLA
GRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLES
GTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTE
SIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTM
DYNYPLCALQAFAIALSSFDSKLACE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagccgcattccgactggattccctacagtgtcttagatgatgagggcaga
aacctgaggcagcagaagcttgatcggcagcgggccctgctggagcagaagcagaagaag
aagcgccaggagcccctgatggtgcaggccaatgcagatgggcggccccggagccggcgg
gcccggcagtcagaggaacaagcccccctggtggagtcctacctcagcagcagtggcagc
accagctaccaagttcaagaggccgactcactcgccagtgtgcagctgggagccacgcgc
ccaacagcaccagcttcagccaagagaaccaaggcggcagctacagcagggggccagggt
ggcgccgctaggaaggagaagaagggaaagcacaaaggcaccagcgggccagcagcactg
gcagaagacaagtctgaggcccaaggcccagtgcagattctgactgtgggccagtcagac
cacgcccaggacgcaggggagacggcagctggtgggggcgaacggcccagcgggcaggat
ctccgtgccacgatgcagaggaagggcatctccagcagcatgagctttgacgaggatgag
gaggatgaggaggagaatagctccagctcctcccagctaaatagtaacacccgccccagc
tctgctactagcaggaagtccgtcagggaggcagcctcagcccctagcccaacagctcca
gagcaaccagtggacgttgaggtccaggatcttgaggagtttgcactgaggccggccccc
cagggtatcaccatcaaatgccgcatcactcgggacaagaaagggatggaccggggcatg
taccccacctactttctgcacctggaccgtgaggatgggaagaaggtgttcctcctggcg
ggaaggaagagaaagaagagtaaaacttccaattacctcatctctgtggacccaacagac
ttgtctcgaggaggggacagctatatcgggaaactgcggtccaacttgatgggcaccaag
ttcactgtttatgacaatggagtcaaccctcagaaggcctcatcctccactttggaaagt
ggaaccttacgtcaggagctggcagctgtgtgctacgagacaaacgtcttaggcttcaag
gggcctcggaagatgagcgtgattgtcccaggcatgaacatggttcatgagagagtctct
atccgcccccgcaacgagcatgagacactgctagcacgctggcagaataagaacacggag
agtatcatcgagctgcaaaacaagacacctgtctggaatgatgacacacagtcctatgta
ctcaacttccatgggcgcgtcacacaggcctccgtgaagaacttccagatcatccatggc
aatgacccggactacatcgtgatgcagtttggccgggtagcagaggatgtgttcaccatg
gattacaactacccgctgtgtgcactgcaggcctttgccattgccctgtccagcttcgac
agcaagctggcgtgcgagtag

DBGET integrated database retrieval system