KEGG   Homo sapiens (human): 727957Help
Entry
727957            CDS       T01001                                 

Gene name
MROH1, HEATR7A
Definition
(RefSeq) maestro heat like repeat family member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 727957
NCBI-ProteinID: NP_115826
HGNC: 26958
Ensembl: ENSG00000179832
Vega: OTTHUMG00000165781
Pharos: Q8NDA8(Tdark)
UniProt: Q8NDA8
Position
8q24.3
AA seq 1641 aa AA seqDB search
MTESSMKKLASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHDKLAHP
YRAAVLRAMERVLSSRASELDKDTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQ
FISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDT
VRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLR
LAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAAVSVGSR
TLETQLDALLAALHSQICVPVESSSPLVMSNQKEVLRCFTVLACSSPDRLLAFLLPRLDT
SNERTRVGTLQVVRHVINSAAAQMEDKKPFILSSMRLPLLDTNSKVKRAVVQVISAMAHH
GYLEQPGGEAMIEYIVQQCALPPEQEPEKPGPGSKDPKADSVRAISVRTLYLVSTTVDRM
SHVLWPYLLQFLTPVRFTGALTPLCRSLVHLAQKRQEAGADAFLIQYDAHASLPSPYAVT
GRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQ
EEWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAAS
SKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIG
ILNIFKDRSENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFSTKVLGIK
VETKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPI
RKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPEPKEEDGGCQKSLYLETLHAL
EDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLRVSALV
PFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLLSLK
DGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCL
LQERGGVLQEKVPEIVSVLRSKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLP
LDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSAT
CALFEVMSTPAAGPAVLELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNL
EPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRL
PLVLKTLACTHSSAYENQRVTTTAFLAELLNSNVANDLMLLDSLLESLAARQKDTCASVR
RLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVES
WDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLL
LHLQDPQATVASACRFALRMCGPNLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHH
FPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLK
DPAPEVRTRAAEALGRLVKLA
NT seq 4926 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtcctccatgaagaagctggcctccaccctgctggacgccatcaccgataag
gaccccctggtgcaggagcaggtctgcagtgccctgtgctccctcggggaggcgcggccg
gtggagacgctccgtgcctgcgaggagtatctgcggcagcatgacaagctggcacaccca
taccgagcagcggtcctgagggccatggagagggtcctgagcagtcgcgccagtgagctg
gacaaggacacagccagcaccatcatcctcctggcctccagcgagatgaccaagacgaag
gacctggtctgggactggcagcaggcggcgagtggcgtcctggtggccgtgggaagacag
ttcatcagcaaggtgatggaggagctgctgcgcaggctgcaccctgggaccctgccacac
tgcgccgtgctgcacaccctcgccagcctctcggtggccaacgcgttcggcgtagtcccc
ttcctgccatccgtcctgagctccctgctgcccgtgctgggcgtggccaagcaggacacg
gtgcgcgtggccttctgctccgctctgcagcgcttcagcgagggtgccctggagtaccta
gccaacctggaccgagccccagaccccacggtcaggaaggacgcctttgccaccgacatc
ttcagcgcctacgatgttctcttccatcagtggctgcagagtcgagaagccaagctccgt
cttgccgtggtggaggctctggggcctatgagccatctgctgcccagtgagaggctggaa
gagcagctgcccaagctcctccctgggattctcgccctctacaagaagcacgcagagacc
ttctacttgtccaagagcctgggccagatcctcgaggcagctgtgagtgtgggcagccgc
acactggagacccagctggatgccctcttggctgcactgcactcccagatctgtgtgcct
gtggagtcctcaagccccctggtgatgagtaaccagaaggaggtgctgcgctgcttcact
gtgctggcctgcagctcgcctgaccgcctactggccttcctgctgcccaggctggacacc
agcaatgagaggacccgcgtgggcaccctgcaggtggtcagacatgtcatcaactcagct
gctgctcagatggaagataaaaagccctttatcctgtcttccatgaggcttcctctcctg
gacaccaacagcaaggtgaagcgggcagtggtgcaggtgattagcgccatggcccaccac
ggctacctggagcagcctggaggtgaggcgatgatcgagtacatcgtgcagcagtgcgcg
ctgccccccgagcaggagcctgagaagccaggccccggcagcaaggaccccaaggccgac
agcgtgcgggccatcagcgtgcgcaccctctacctggtcagcaccaccgtggacaggatg
agtcacgtcctctggccatacctgctccagttcctcacccctgtgcgcttcactggggcc
ctgactccgctctgcaggagcctcgtgcatctggcgcagaagaggcaggaggccggggcc
gacgccttcctcatccagtacgacgcccatgcgagcctcccgtctccctatgctgtaacc
ggaagactgttggttgtgtcttccagcccctacctaggggacggacgtggggcagcggcg
ctgcgcctcctcagtgttctgcacccaaacattcaccctttgctgggtcagcattgggaa
acgactgtcccgctgctgctggggtacctggatgagcacacagaagagaccctgccacag
gaggagtgggaggagaagctgttgatgttcctgcgagacaccctggccatcatttctgac
aacgcgtggatctgccagctgagcctggagctgtgcaggcagctgccctgctacgatgag
gcaccccaggagaagaacttcctgtacaaatgcataggcaccaccctgggtgctgcttca
agtaaggaggtggtgaggaagcaccttcaagagctgctggagacggccagataccaggag
gaggcagaacgcgagggcctcgcctgctgcttcgggatctgtgccatctcccacctcgag
gacacgctggcccagctggaggacttcgtgaggtcagaggtcttcagaaaatccattggc
attctcaacatttttaaggatcgaagtgagaacgaagtggagaaggtgaagagtgctctg
atcctgtgctatgggcacgtggcggcccgggccccccgggagctggtgctggccaaggta
gagtcagacatcctccggaacatctgccagcacttcagcaccaaggttctaggaataaag
gtagaaaccaaggacccagccctgaagctgtgccttgtccagagtgtgtgcatggtcagc
cgcgccatctgcagcagcacccaggctggctccttccacttcacccggaaagcagagctg
gtggcacagatgatggagttcatcagggcagagcccccggactccttgaggacacctatt
cggaagaaagccatgctcacctgcacttacttggtctccgtggagccagcgctggacgag
caggcccgggcggatgtgatccatggctgcctgcacagcatcatggccctgctgcctgag
cccaaggaggaggacggaggctgccagaagtccctgtatctggagacactgcacgccctt
gaggatctgctgacgagcctcctgcagcggaacatgaccccccaaggcctgcagatcatg
attgagcacctgagcccatggatcaagtccccaagaggtcacgagcgggcgcgggccctg
ggcctgagcgccctcctgctgcgctacttcctggagcacctgcgtgtcagcgccctggtg
cccttccacaacctgggccttctcatcggcctcttctccccacggtgtgcggacctgtgg
cctgccacccgccaggaggccgtggactgtgtctactccctgctgtacctccagctcggc
tatgagggcttctcccgggactaccgcgatgacgtggcggagcggctcctcagcctcaag
gacggcctcgtgcaccctgaccccgccattctcttccacacctgccacagtgtaggccag
attattgccaagcgcctccccccagaccagctcatcagcctcttgctaaccatgtttgag
gccctgggagaccccgaaaagaactgctcccgagcagctaccgtcatgatcaactgcctg
ctgcaggagcggggcggtgtgctccaggagaaggtgcccgagatcgtgagcgtcctgcgc
tccaagcttcaggaggcccagggagagcacgtcctgccggccgcccagcacagcgtgtac
ctcctggccacccagcactgcgcagccgtggtgtccagcctcctgggcagccccttgccc
ttggacagccacacctgcatgctgtggcgggcgctggcggtggagcctcgcctagctgcc
caggtcctggggctgctgctggagaagatgagtagggacgtccctttcaaggagagccgg
gccttcctgctgggccgcaccccagaccgcgtggccacgctgctgcctctctcggctacc
tgtgcactgtttgaggtcatgtccacgcctgcagcggggcccgcggtgctcgagctctac
ccccagctgtttgtggtgcttctgctgcgcgtcagctgcaccgtgggtgtccagctgccc
cggaacctgcaggcccaggaaaggaggggtgccagtccagccctagccaccaggaacctg
gaaccctgcagctctgcagtggacaccctgcggtccatgctactccgcagcggcagcgag
gatgtggtacagcgcatggacctggagggaggctgggaactgctcaggacctcggcgggg
catgaggagggggccaccaggttggccagggccatggctgagcacgcagggccccgactc
cccctggtgctgaagacgctggcatgcacacacagcagtgcgtatgagaaccagagggtg
accaccaccgccttcctggccgagctgctgaacagcaacgtggccaacgacctcatgctc
ttggactcgctgctggagagcctggcggctcgccagaaggacacatgcgccagcgtgcgg
aggctggtgctccgcggcctggccaacctggcctccggctgccctgacaaggtgcgaacc
cacggcccccagctcctcacagccatgattggcgggctggacgacggggacaaccctcac
agcccagtggccctggaggccatgctgggccttgcgaggctggtgcacctggtggagtcc
tgggacctgcgctcagggctgctgcacgtggccatccgcatccggcctttcttcgacagt
gagaagatggagttccggacggcatctatccgcctctttgggcaccttaacaaggtctgc
cacggagactgtgaggacgtcttcctggaccaggtggtgggcgggctggcgcccctgctg
ctgcacctgcaggaccctcaggccaccgtggccagcgcctgcaggtttgccctgcgcatg
tgtggccccaatctggcatgtgaggagctctcagctgctttccagaaacacctgcaggag
ggccgagccctgcacttcggggagttcctcaacaccacctgcaagcacctgatgcaccat
ttcccagacctgctgggccgtctcctgaccacctgcctgttctacttcaagagcagctgg
gagaacgtccgagctgctgcacccctgttcaccgggttcctggtgctgcactcggagccc
aggcagcagccgcaggtggacctggaccagctcattgcggcgctccagatcctgctgaag
gacccggcccccgaggtgcggacgagggctgctgaggccctgggccgcctggtgaagctc
gcctaa

DBGET integrated database retrieval system