KEGG   Homo sapiens (human): 728Help
Entry
728               CDS       T01001                                 

Gene name
C5AR1, C5A, C5AR, C5R1, CD88
Definition
(RefSeq) complement C5a receptor 1
  KO
K04010  C5a anaphylatoxin chemotactic receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Drug target
Avacopan: D11093
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    728 (C5AR1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    728 (C5AR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    728 (C5AR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    728 (C5AR1)
   04090 CD molecules [BR:hsa04090]
    728 (C5AR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    728 (C5AR1)
CD molecules [BR:hsa04090]
 Proteins
  728 (C5AR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 728
NCBI-ProteinID: NP_001727
OMIM: 113995
HGNC: 1338
Ensembl: ENSG00000197405
Vega: OTTHUMG00000183504
Pharos: P21730(Tchem)
UniProt: P21730
Structure
PDB: 

Position
19q13.32
AA seq 350 aa AA seqDB search
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggactccttcaattataccacccctgattatgggcactatgatgacaaggataccctg
gacctcaacacccctgtggataaaacttctaacacgctgcgtgttccagacatcctggcc
ttggtcatctttgcagtcgtcttcctggtgggagtgctgggcaatgccctggtggtctgg
gtgacggcattcgaggccaagcggaccatcaatgccatctggttcctcaacttggcggta
gccgacttcctctcctgcctggcgctgcccatcttgttcacgtccattgtacagcatcac
cactggccctttggcggggccgcctgcagcatcctgccctccctcatcctgctcaacatg
tacgccagcatcctgctcctggccaccatcagcgccgaccgctttctgctggtgtttaaa
cccatctggtgccagaacttccgaggggctggcttggcctggatcgcctgtgccgtggct
tggggtttagccctgctgctgaccataccctccttcctgtaccgggtggtccgggaggag
tactttccaccaaaggtgttgtgtggcgtggactacagccacgacaaacggcgggagcga
gccgtggccatcgtccggctggtcctgggcttcctgtggcctctactcacgctcacgatt
tgttacactttcatcctgctccggacgtggagccgcagggccacgcggtccaccaagaca
ctcaaggtggtggtggcagtggtggccagtttctttatcttctggttgccctaccaggtg
acggggataatgatgtccttcctggagccatcgtcacccaccttcctgctgctgaagaag
ctggactccctgtgtgtctcctttgcctacatcaactgctgcatcaaccccatcatctac
gtggtggccggccagggcttccagggccgactgcggaaatccctccccagcctcctccgg
aacgtgttgactgaagagtccgtggttagggagagcaagtcattcacgcgctccacagtg
gacactatggcccagaagacccaggcagtgtag

DBGET integrated database retrieval system