KEGG   Homo sapiens (human): 7280
Entry
7280              CDS       T01001                                 
Symbol
TUBB2A, CDCBM5, TUBB, TUBB2
Name
(RefSeq) tubulin beta 2A class IIa
  KO
K07375  tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04540  Gap junction
hsa04814  Motor proteins
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06180  Pathogenic Escherichia coli
nt06181  Salmonella
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
nt06466  Pathways of neurodegeneration
nt06515  Regulation of kinetochore-microtubule interactions
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01285  Microtubule-RHOA signaling pathway
N01286  Escherichia EspG to Microtubule-RHOA signaling pathway
N01295  Rab7-regulated microtubule minus-end directed transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
N01403  Zn to anterograde axonal transport
N01414  Iron to anterograde axonal transport
N01535  Kinetochore microtubule attachment
N01544  Microtubule nucleation
N01547  Kinetochore fiber organization
N01549  Branching microtubule nucleation
N01553  Promotion of microtubule growth
N01561  Microtubule depolymerization
N01562  Microtubule depolymerization at the minus ends
Disease
H01881  Complex cortical dysplasia with other brain malformations
Drug target
Anvatabart opadotin: D12583
Avanbulin: D11681
Batabulin (DG01412): D03059 D06560
Belantamab mafodotin: D11595<US>
Brentuximab vedotin: D09587<JP/US>
Cabazitaxel (DG00695): D09755 D10452<JP/US>
Cantuzumab mertansine: D03364
Cantuzumab ravtansine: D10454
Cevipabulin (DG01413): D06576 D08889
Colchicine: D00570<JP/US>
Denintuzumab mafodotin: D11232
Docetaxel (DG00694): D02165<JP/US> D07866<JP/US>
Enfortumab vedotin: D11525<JP/US>
Eribulin: D08914<JP/US>
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Farletuzumab ecteribulin: D12183
Glembatumumab vedotin: D09912
Indibulin: D10013
Ixabepilone: D04645<US>
Lexibulin: D10073
Lifastuzumab vedotin: D11238
Lisavanbulin: D11494
Lorvotuzumab mertansine: D09927
Maytansine: D04864
Mecbotamab vedotin: D12220
Mirvetuximab soravtansine: D10954<US>
Mivobulin isethionate: D05062
Oberotatug ravtansine: D12916
Opadotin: D12582
Ozuriftmab vedotin: D12210
Paclitaxel: D00491<JP/US>
Paclitaxel poliglumex: D05333
Sabizabulin (DG03253): D12519 D12520
Soblidotin: D01919
Soravtansine: D11228
Taltobulin: D06001
Tasidotin hydrochloride: D06009
Tirbanibulin (DG03082): D11691<US> D11692
Tisotumab vedotin: D11814<US>
Trastuzumab emtansine: D09980<JP/US>
Tusamitamab ravtansine: D12310
Vedotin: D09691
Verubulin (DG01411): D10029 D10030
Vinblastine (DG00689): D01068<JP/US> D08675
Vincristine (DG00690): D02197<JP/US> D08679
Vindesine (DG00691): D01769<JP> D06304
Vinepidine sulfate: D06305
Vinflunine: D09032
Vinglycinate sulfate: D06306
Vinleurosine sulfate: D06307
Vinorelbine (DG00692): D01935<JP/US> D08680
Vinrosidine sulfate: D06308
Vinzolidine sulfate: D06309
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7280 (TUBB2A)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    7280 (TUBB2A)
  09142 Cell motility
   04814 Motor proteins
    7280 (TUBB2A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7280 (TUBB2A)
   05132 Salmonella infection
    7280 (TUBB2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7280 (TUBB2A)
   05012 Parkinson disease
    7280 (TUBB2A)
   05014 Amyotrophic lateral sclerosis
    7280 (TUBB2A)
   05016 Huntington disease
    7280 (TUBB2A)
   05020 Prion disease
    7280 (TUBB2A)
   05022 Pathways of neurodegeneration - multiple diseases
    7280 (TUBB2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7280 (TUBB2A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7280 (TUBB2A)
   04147 Exosome [BR:hsa04147]
    7280 (TUBB2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     7280 (TUBB2A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7280 (TUBB2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7280 (TUBB2A)
  Exosomal proteins of colorectal cancer cells
   7280 (TUBB2A)
  Exosomal proteins of bladder cancer cells
   7280 (TUBB2A)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 7280
NCBI-ProteinID: NP_001060
OMIM: 615101
HGNC: 12412
Ensembl: ENSG00000137267
UniProt: Q13885
Structure
Position
6:complement(3153666..3157544)
AA seq 445 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcgcgagatcgtgcacatccaggcgggccagtgcggcaaccagatcggcgccaagttt
tgggaggtcatcagcgatgagcatgggatcgaccccacaggcagttaccatggagacagt
gacttgcagctggagagaatcaacgtgtactacaatgaggctgctggtaacaaatatgta
cctcgggccatcctggtggatctggagcctggcaccatggactctgtcaggtctggaccc
ttcggccagatcttcagaccagacaacttcgtgttcggccagagtggagccgggaataac
tgggccaagggccactacacagagggagccgagctggtcgactcggtcctggatgtggtg
aggaaggagtcagagagctgtgactgtctccagggcttccagctgacccactctctgggg
ggcggcacggggtccgggatgggcaccctgctcatcagcaagatccgggaagagtaccca
gaccgcatcatgaacaccttcagcgtcatgccctcacccaaggtgtcagacacggtggtg
gagccctacaacgccaccctctctgtccaccagctggtggaaaacacagatgaaacctac
tccattgataacgaggccctgtatgacatctgcttccgcaccctgaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgcagacctgcgcaagctggcggtgaacatggtgcccttc
cctcgcctgcacttcttcatgcccggcttcgcgcccctgaccagccggggcagccagcag
taccgggcgctcacggtgcccgagctcacccagcagatgttcgactccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggctgccatcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgacgaacaaggggagttcgaggaggaggag
ggcgaggacgaggcttaa

DBGET integrated database retrieval system