KEGG   Homo sapiens (human): 728049Help
Entry
728049            CDS       T01001                                 

Gene name
CT47A8, CT47.8
Definition
(RefSeq) cancer/testis antigen family 47 member A8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CT47
Motif
Other DBs
NCBI-GeneID: 728049
NCBI-ProteinID: NP_001073608
OMIM: 300787
HGNC: 33289
Ensembl: ENSG00000230347
Vega: OTTHUMG00000022318
UniProt: Q5JQC4
Position
Xq24
AA seq 288 aa AA seqDB search
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIH
FVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAA
RAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTA
QEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaggggaccgacacccgacccaaggggaccaggaggccccggtaagccag
gagggagcacaggccgaggcggccggagctggtaaccaggagggcggcgactccggcccc
gacagcagcgacgtggtgcctgcggccgaggtggtcggagtcgcagggcccgtggaaggc
ctcggggaggaggagggtgagcaggcggcaggcctggccgcagtcccccggggcgggagc
gccgaggaggactcagatatcgggcccgcgacggaggaagaggaggaggaagaggggaac
gaggcggccaacttcgacttggcggtggtcgcccgtcgctacccggcgtcgggcattcac
ttcgtgctcctggacatggtccactcccttctccaccgcctctctcacaacgaccacatc
ctcatagagaaccgtcaactcagccgcctgatggtggggccacacgctgctgcgcgcaac
ctctggggcaacctccccccgctgctgctgccccagaggctgggtgcaggggccgcagcc
cgggcgggcgagggcctgggcctgatccaggaggccgcatcggtcccagagcctgcagtg
ccagctgacctggccgagatggccagggagcccgcggaggaggccgcagaggagaagctc
tcagaggaggccacagaggaaccagacgcagaggaaccggccacagaagaaccgaccgca
caggaggccacggccccagaggaagtcactaaatctcagcccgaaaagtgggatgaagag
gcccaagatgctgcaggcgaggaagagaaagaacaagaaaaagagaaggatgcggaaaac
aaggtgaagaactccaaagggacctag

DBGET integrated database retrieval system