KEGG   Homo sapiens (human): 728062Help
Entry
728062            CDS       T01001                                 

Gene name
CT47A6, CT47.6
Definition
(RefSeq) cancer/testis antigen family 47 member A6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CT47
Motif
Other DBs
NCBI-GeneID: 728062
NCBI-ProteinID: NP_001073610
OMIM: 300785
HGNC: 33287
Ensembl: ENSG00000226023
Vega: OTTHUMG00000022316
UniProt: Q5JQC4
Position
Xq24
AA seq 288 aa AA seqDB search
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIH
FVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAA
RAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTA
QEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaggggaccgacacccgacccaaggggaccaggaggccccggtaagccag
gagggagcacaggccgaggcggccggagctggtaaccaggagggcggcgactccggcccc
gacagcagcgacgtggtgcctgcggccgaggtggtcggagtcgcagggcccgtggaaggc
ctcggggaggaggagggtgagcaggcggcaggcctggccgcagtcccccggggcgggagc
gccgaggaggactcagatatcgggcccgcgacggaggaagaggaggaggaagaggggaac
gaggcggccaacttcgacttggcggtggtcgcccgtcgctacccggcgtcgggcattcac
ttcgtgctcctggacatggtccactcccttctccaccgcctctctcacaacgaccacatc
ctcatagagaaccgtcaactcagccgcctgatggtggggccacacgctgctgcgcgcaac
ctctggggcaacctccccccgctgctgctgccccagaggctgggtgcaggggccgcagcc
cgggcgggcgagggcctgggcctgatccaggaggccgcatcggtcccagagcctgcagtg
ccagctgacctggccgagatggccagggagcccgcggaggaggccgcagaggagaagctc
tcagaggaggccacagaggaaccagacgcagaggaaccagccacagaagaaccgaccgca
caggaggccacggccccagaggaagtcactaaatctcagcccgaaaagtgggatgaagag
gcccaagatgctgcaggcgaggaagagaaagaacaagaaaaagagaaggatgcagaaaac
aaggtgaagaactccaaagggacctag

DBGET integrated database retrieval system