KEGG   Homo sapiens (human): 728075Help
Entry
728075            CDS       T01001                                 

Gene name
CT47A4, CT47.4
Definition
(RefSeq) cancer/testis antigen family 47 member A4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CT47
Motif
Other DBs
NCBI-GeneID: 728075
NCBI-ProteinID: NP_001073612
OMIM: 300783
HGNC: 33285
Ensembl: ENSG00000230594
Vega: OTTHUMG00000022314
UniProt: Q5JQC4
Position
Xq24
AA seq 288 aa AA seqDB search
MSATGDRHPTQGDQEAPVSQEGAQAEAAGAGNQEGGDSGPDSSDVVPAAEVVGVAGPVEG
LGEEEGEQAAGLAAVPRGGSAEEDSDIGPATEEEEEEEGNEAANFDLAVVARRYPASGIH
FVLLDMVHSLLHRLSHNDHILIENRQLSRLMVGPHAAARNLWGNLPPLLLPQRLGAGAAA
RAGEGLGLIQEAASVPEPAVPADLAEMAREPAEEAAEEKLSEEATEEPDAEEPATEEPTA
QEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKGT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacaggggaccgacacccgacccaaggggaccaggaggccccggtaagccag
gagggagcacaggccgaggcggccggagctggtaaccaggagggcggcgactccggcccc
gacagcagcgacgtggtgcctgcggccgaggtggtcggagtcgcagggcccgtggaaggc
ctcggggaggaggagggtgagcaggcggcaggcctggccgcagtcccccggggcgggagc
gccgaggaggactcagatatcgggcccgcgacggaggaagaggaggaggaagaggggaac
gaggcggccaacttcgacttggcggtggtcgcccgtcgctacccggcgtcgggcattcac
ttcgtgctcctggacatggtccactcccttctccaccgcctctctcacaacgaccacatc
ctcatagagaaccgtcaactcagccgcctgatggtggggccacacgctgctgcgcgcaac
ctctggggcaacctccccccgctgctgctgccccagaggctgggtgcaggggccgcagcc
cgggcgggcgagggcctgggcctgatccaggaggccgcatcggtcccagagcctgcagtg
ccagctgacctggccgagatggccagggagcccgcggaggaggccgcagaggagaagctc
tcagaggaggccacagaggaaccagacgcagaggaaccggccacagaagaaccgaccgca
caggaggccacggccccagaggaagtcactaaatctcagcccgaaaagtgggatgaagag
gcccaagatgctgcaggcgaggaagagaaagaacaagaaaaagagaaggatgcggaaaac
aaggtgaagaactccaaagggacctag

DBGET integrated database retrieval system