KEGG   Homo sapiens (human): 728194Help
Entry
728194            CDS       T01001                                 

Gene name
RSPH10B2
Definition
(RefSeq) radial spoke head 10 homolog B2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MORN
Motif
Other DBs
NCBI-GeneID: 728194
NCBI-ProteinID: NP_001093167
HGNC: 34385
Ensembl: ENSG00000169402
Vega: OTTHUMG00000151856
Pharos: B2RC85(Tdark)
UniProt: B2RC85
Position
7p22.1
AA seq 870 aa AA seqDB search
MVKEKKKADKKGEKSARSPSSLSDNLDFSKQDGNTTRQEMSPAGVPLLGMQLNEVKPKKD
RQNVQQNEDASQYEESILTKLIVESYEGEKVRGLYEGEGFAAFQGGCTYRGMFSEGLMHG
QGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYI
GHWCNGKRHGKGSIYYNQEGTCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEG
RMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFY
YASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVA
PRLSRSAELIRKLDGSESHSVLGSSIELDLNLLLDMYPETVQPEEKKQVEYAVLRNITEL
RRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHHKLTLADMDRILSANNDIPVEE
IHSPFTTILLRTFLNYLLHLAYHIYHEEFQKRSPSLFLCFTKLMTENIRPNACQIKGNLF
REQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATF
MEVIAEDNRFIYDGIDSNFEPELVFLEFFEALLSFAFICVTDQMTKSYTNVPADDVSGNK
HETIYTILNQDAQNKSPSAVMSHESDAAHSDSARSSSSKLELSPDVNKIRKSEPKIKKSV
SHERVSKMNFKLTGKGITFFSSESKKYERPKDDREEEFNTWVNNTYVFFVNTLFHAYKRE
EAIKEKIRADRLRSTAQAQQRKMEDDELEARLNIFILREEEAKRHDYEVDITVLKEPADV
SSSHLILDPPKEDVTVSPSSKTITSKKKKK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaaagaaaaaagcagacaaaaaaggggagaagtctgcccgctctccctca
tctctctctgataatctagacttttccaaacaagatggcaacaccactaggcaagagatg
tccccagctggtgtcccattgctgggaatgcagctcaacgaagtgaaacccaaaaaagac
cgccaaaacgttcagcagaacgaagatgccagccaatacgaagagtccattctgaccaaa
ctcatagtggaaagctatgaaggggaaaaggttcgtgggctgtatgagggagaaggcttc
gcagcctttcaaggcggttgtacctatcgtggtatgttttcagaaggactcatgcatgga
caggggacttatatttgggccgatggattaaaatatgagggcgactttgtgaagaatgtc
ccgatgaaccacggcgtgtacacgtggccggacggcagcatgtatgaaggcgaagtggtc
aacggcatgaggaacggattcgggatgttcaagtgcagcacccagcctgtgtcctacatc
ggccactggtgcaatggcaagcggcacgggaagggctccatttattacaatcaagagggt
acgtgttggtacgagggagactgggtacaaaacatcaaaaagggctggggaataagatgt
tataaatctggaaatatatacgaaggccagtgggaagacaacatgcgccacggggagggg
aggatgaggtggctgaccaccaacgaagagtacaccgggcggtgggagaggggcatccag
aatggctttggaacacacacatggtttctaaagagaatccgcagttcccagtatcctttg
agaaatgaatacataggggagtttgtaaatggatatcgtcacggacgtggcaagttttat
tatgccagtggagccatgtatgatggagaatgggtttccaataagaaacatggcatgggc
cgattaactttcaagaacgggcgtgtgtacgaaggcgcattctccaatgaccacatagct
gggtttccggatcttgaagttgaattcatcagctgcctggacctgtcttcaggagttgcc
ccaagactgtccaggagcgccgaactgatcagaaagcttgatggcagtgaaagtcattct
gtgttgggatcgagcattgagctggatctaaatttgctcctggacatgtaccctgagaca
gtccaacctgaagaaaagaagcaggtggaatatgccgtcttaagaaatattacagaatta
agaagaatttacagcttttacagcagcctgggatgcggccactctctggataataccttt
ctgatgacaaagcttcacttctggagatttctaaaagattgcaaatttcatcaccacaaa
ctaactcttgctgatatggacaggatattaagtgccaataatgacataccagttgaagaa
atccattctccatttacaacaatacttttgagaacatttttgaattacctcctgcatttg
gcgtaccacatttatcatgaagaattccaaaagagaagcccatccctcttcttgtgtttt
acaaaactgatgaccgagaacattcgtccaaatgcctgccagataaaaggcaatttattc
cgtgagcaacagcggacgctctactctatgagttacatgaataagtgctgggagatttat
ctcgcttactgcagacccagtgcagcgcctccccacgagcctacgatgaagatgagacac
ttcctctggatgctgaaagactttaaaatgataaataaagaattaacagcagctacattt
atggaggtcatagcagaggataatcgtttcatatatgatggaattgacagcaactttgaa
cctgagctggttttcctggaattctttgaagctctcttaagctttgcattcatctgtgtt
actgaccaaatgactaaatcctatacaaatgttccagctgatgatgtgtctggaaataaa
catgaaactatttatacaatactaaatcaggacgcccagaacaagagtcccagcgcggtc
atgagccacgaatcggatgctgctcactctgacagtgccaggtcatcttccagcaagtta
gaactctcgcctgatgttaacaaaataaggaaatcagagcccaagatcaagaagtctgta
agtcatgaaagagtctccaaaatgaattttaaattgactggaaaagggatcacctttttc
tcatctgagagcaagaaatatgagagacccaaggatgatcgagaggaagagttcaacacg
tgggtcaataatacgtacgtcttctttgtgaacacgctctttcatgcgtataaacgtgaa
gaagctatcaaggagaaaataagggcagacaggttacgtagcacagcacaggcccagcag
cggaagatggaagatgacgaactggaagcaaggctgaacatctttatcttgagagaggaa
gaggccaagagacatgactatgaggtggacatcacagtgctcaaggagccggcagacgtg
tcatcctctcacctcatactggaccctcccaaggaggatgtgaccgtgtccccatccagc
aagaccatcaccagcaagaagaagaaaaagtag

DBGET integrated database retrieval system