KEGG   Homo sapiens (human): 7283Help
Entry
7283              CDS       T01001                                 

Gene name
TUBG1, CDCBM4, GCP-1, TUBG, TUBGCP1
Definition
(RefSeq) tubulin gamma 1
  KO
K10389  tubulin gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Disease
H01881  Complex cortical dysplasia with other brain malformations
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    7283 (TUBG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7283 (TUBG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7283 (TUBG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     7283 (TUBG1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7283 (TUBG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 7283
NCBI-ProteinID: NP_001061
OMIM: 191135
HGNC: 12417
Ensembl: ENSG00000131462
Vega: OTTHUMG00000180277
Pharos: P23258(Tbio)
UniProt: P23258
Structure
PDB: 

Position
17q21.2
AA seq 451 aa AA seqDB search
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggaaatcatcaccctacagttgggccagtgcggcaatcagattgggttcgag
ttctggaaacagctgtgcgccgagcatggtatcagccccgagggcatcgtggaggagttc
gccaccgagggcactgaccgcaaggacgtctttttctaccaggcagacgatgagcactac
atcccccgggccgtgctgctggacttggaaccccgggtgatccactccatcctcaactcc
ccctatgccaagctctacaacccagagaacatctacctgtcggaacatggaggaggagct
ggcaacaactgggccagcggattctcccagggagaaaagatccatgaggacatttttgac
atcatagaccgggaggcagatggtagtgacagtctagagggctttgtgctgtgtcactcc
attgctggggggacaggctctggactgggttcctacctcttagaacggctgaatgacagg
tatcctaagaagctggtgcagacatactcagtgtttcccaaccaggacgagatgagcgat
gtggtggtccagccttacaattcactcctcacactcaagaggctgacgcagaatgcagac
tgtgtggtggtgctggacaacacagccctgaaccggattgccacagaccgcctgcacatc
cagaacccatccttctcccagatcaaccagctggtgtctaccatcatgtcagccagcacc
accaccctgcgctaccctggctacatgaacaatgacctcatcggcctcatcgcctcgctc
attcccaccccacggctccacttcctcatgaccggctacacccctctcactacggaccag
tcagtggccagcgtgaggaagaccacggtcctggatgtcatgaggcggctgctgcagccc
aagaacgtgatggtgtccacaggccgagaccgccagaccaaccactgctacatcgccatc
ctcaacatcatccagggagaggtggaccccacccaggtccacaagagcttgcagaggatc
cgggaacgcaagttggccaacttcatcccgtggggccccgccagcatccaggtggccctg
tcgaggaagtctccctacctgccctcggcccaccgggtcagcgggctcatgatggccaac
cacaccagcatctcctcgctcttcgagagaacctgtcgccagtatgacaagctgcgtaag
cgggaggccttcctggagcagttccgcaaggaggacatgttcaaggacaactttgatgag
atggacacatccagggagattgtgcagcagctcatcgatgagtaccatgcggccacacgg
ccagactacatctcctggggcacccaggagcagtga

DBGET integrated database retrieval system