KEGG   Homo sapiens (human): 728318
Entry
728318            CDS       T01001                                 

Gene name
KRTAP9-1, KAP9.1, KRTAP9L3
Definition
(RefSeq) keratin associated protein 9-1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 728318
NCBI-ProteinID: NP_001177389
HGNC: 18912
Ensembl: ENSG00000240542
Vega: OTTHUMG00000133636
Pharos: A8MXZ3(Tdark)
UniProt: A8MXZ3
Position
17q21.2
AA seq 250 aa
MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVPSCCQPCCHPTCCQNT
CCRTTCCQPTCVASCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCCQPICGSSCCQPCCH
PTCYQTICFRTTCCQPTCCQPTCCRNTSCQPTCCGSSCCQPCCHPTCCQTICRSTCCQPS
CVTRCCSTPCCQPTCGGSSCCSQTCNESSYCLPCCRPTCCQTTCYRTTCCRPSCCCSPCC
VSSCCQPSCC
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacccactgctgttccccttgctgtcagcctacatgctgcaggaccacctgctgcagg
acaacctgctggaagcccaccactgtgaccacctgcagcagcacaccctgttgccagccc
tcctgctgtgtgcccagctgctgccagccttgctgccacccaacttgctgtcaaaacacc
tgctgcaggaccacctgctgccagcccacttgtgtggccagctgctgccagccttcctgc
tgcagcacaccctgctgccagcccacctgctgtgggtccagctgctgtggccaaaccagc
tgtgggtccagctgctgtcagcctatttgtgggtccagttgctgtcagccttgctgtcac
ccgacttgctatcaaactatctgcttcaggaccacctgctgccagcctacctgctgccag
cccacctgctgcaggaacacctcttgccagcccacctgctgtgggtccagctgctgccag
ccttgctgccacccaacatgctgtcaaaccatttgtagatccacctgctgccaaccatcc
tgtgtgaccagatgctgcagcacaccctgttgccagccaacctgtggtgggtccagctgc
tgtagccaaacctgcaatgagtccagctattgtctgccttgctgccgtcccacctgctgc
cagaccacctgctacaggaccacctgttgccgccccagctgttgctgcagtccttgctgt
gtctccagctgctgccagccttcctgctgctaa

DBGET integrated database retrieval system