KEGG   Homo sapiens (human): 728358Help
Entry
728358            CDS       T01001                                 

Gene name
DEFA1B, HNP-1, HP-1, HP1
Definition
(RefSeq) defensin alpha 1B
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    728358 (DEFA1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    728358 (DEFA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_propep Defensin_1 DUF4733
Motif
Other DBs
NCBI-GeneID: 728358
NCBI-ProteinID: NP_001035965
HGNC: 33596
Ensembl: ENSG00000240247
Vega: OTTHUMG00000149850
Pharos: P59665(Tbio)
UniProt: P59665
Structure
PDB: 

Position
8p23.1
AA seq 94 aa AA seqDB search
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctcgccatccttgctgccattctcctggtggccctgcaggcccaggctgag
ccactccaggcaagagctgatgaggttgctgcagccccggagcagattgcagcggacatc
ccagaagtggttgtttcccttgcatgggacgaaagcttggctccaaagcatccaggctca
aggaaaaacatggcctgctattgcagaataccagcgtgcattgcaggagaacgtcgctat
ggaacctgcatctaccagggaagactctgggcattctgctgctga

DBGET integrated database retrieval system