KEGG   Homo sapiens (human): 728458Help
Entry
728458            CDS       T01001                                 

Gene name
OPN1MW2, GOP
Definition
(RefSeq) opsin 1, medium wave sensitive 2
  KO
K04251  long/medium wavelength-sensitive opsin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    728458 (OPN1MW2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    728458 (OPN1MW2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srv Cytochrom_B_N_2 7tm_4
Motif
Other DBs
NCBI-GeneID: 728458
NCBI-ProteinID: NP_001041646
HGNC: 26952
Ensembl: ENSG00000166160
Vega: OTTHUMG00000024231
Pharos: P04001(Tdark)
UniProt: P0DN77 P0DN78 P04001
Position
Xq28
AA seq 364 aa AA seqDB search
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFH
PLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagtggagcctccaaaggctcgcaggccgccatccgcaggacagctatgag
gacagcacccagtccagcatcttcacctacaccaacagcaactccaccagaggccccttc
gaaggcccgaattaccacatcgctcccagatgggtgtaccacctcaccagtgtctggatg
atctttgtggtcattgcatccgtcttcacaaatgggcttgtgctggcggccaccatgaag
ttcaagaagctgcgccacccgctgaactggatcctggtgaacctggcggtcgctgacctg
gcagagaccgtcatcgccagcactatcagcgttgtgaaccaggtctatggctacttcgtg
ctgggccaccctatgtgtgtcctggagggctacaccgtctccctgtgtgggatcacaggt
ctctggtctctggccatcatttcctgggagagatggatggtggtctgcaagccctttggc
aatgtgagatttgatgccaagctggccatcgtgggcattgccttctcctggatctgggct
gctgtgtggacagccccgcccatctttggttggagcaggtactggccccacggcctgaag
acttcatgcggcccagacgtgttcagcggcagctcgtaccccggggtgcagtcttacatg
attgtcctcatggtcacctgctgcatcaccccactcagcatcatcgtgctctgctacctc
caagtgtggctggccatccgagcggtggcaaagcagcagaaagagtctgaatccacccag
aaggcagagaaggaagtgacgcgcatggtggtggtgatggtcctggcattctgcttctgc
tggggaccctacgccttcttcgcatgctttgctgctgccaaccctggctaccccttccac
cctttgatggctgccctgccggccttctttgccaaaagtgccactatctacaaccccgtt
atctatgtctttatgaaccggcagtttcgaaactgcatcttgcagcttttcgggaagaag
gttgacgatggctctgaactctccagcgcctccaaaacggaggtctcatctgtgtcctcg
gtatcgcctgcatga

DBGET integrated database retrieval system