KEGG   Homo sapiens (human): 728464Help
Entry
728464            CDS       T01001                                 

Gene name
METTL24, C6orf186
Definition
(RefSeq) methyltransferase like 24
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_22 Methyltransf_21
Motif
Other DBs
NCBI-GeneID: 728464
NCBI-ProteinID: NP_001116836
HGNC: 21566
Ensembl: ENSG00000053328
Vega: OTTHUMG00000015359
Pharos: Q5JXM2(Tdark)
UniProt: Q5JXM2
Position
6q21
AA seq 366 aa AA seqDB search
MARERPPGRGCGVLRRCLLGAVLLFGLRLCAELRRAGPGSPTRSAPPGPAWRPPGPHLPP
APGQPRGASRRQVTYVRSGRRAPPGGGGSGTPEPGCCAPRGRPRRKGPRWHIDLQPWAGS
AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQC
RLYSLGLGSDDTHFEVSMANNGCEVHRFDPSVKSAHILESQHLWYHRLSIDWRDPHPAVA
AQKPHSNTRKLGSILNEFGHHKIDVLKADLESAEWKVLENLILEDVLEQIGQLIFEIHLH
WPGFEVSGSDSSVVRFWYSLLKELEQKDFRLFHSYKDLSKPQLFLKKDIFNASSCYTLSW
VNTRWK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaggccgcccgggaggggctgcggcgtcctgcgccggtgtctactcggg
gctgtgctgttgttcggcctgcggctctgcgcagagctgcggcgcgccgggcccgggtcc
cccacccgcagcgccccgccgggcccggcctggcggccacctgggccgcacctgccgccc
gcgccgggccagccgcgcggcgccagcaggaggcaggtgacctacgtgcgcagcggtcgc
cgggcgccgccggggggcggcgggagcgggacgccggagcctggctgctgtgccccgcgc
gggcgcccccgccggaagggtccccggtggcatatagatctccagccttgggcaggctct
gctcagtccctggatgaagaagcctggaggttcctgagatatatcagcaccacccagatt
gcatgcaatcacatgaatacagacagcctggctactgactctagtcctacacacaagccc
tggtcagtgtgtcttgacgacaggttcaatttagctcatcaaatccgcaacaagcagtgc
cgcctctactccttagggctaggaagtgatgatacccattttgaggttagcatggccaac
aacggatgtgaagtgcatcgttttgatcctagtgtcaagtcagctcacattctggagagt
cagcacctttggtatcaccgcttgtccattgactggcgggatccccatccagctgttgct
gcccaaaaaccacatagcaacaccagaaaactgggaagcattttgaatgaatttggacat
cacaagattgacgttctcaaggcagatctggaaagtgcagaatggaaagttttggaaaat
cttattctggaagatgttcttgagcagattggacagctcatctttgagatccatctccac
tggcctgggtttgaggtcagtggcagtgacagcagcgttgtgcggttctggtacagcctt
ctcaaagagttagaacaaaaggatttcaggctttttcacagttacaaagacttatctaaa
cctcagctattcttgaagaaagacattttcaatgcaagtagctgttatactctgagttgg
gtgaatacaagatggaaatag

DBGET integrated database retrieval system