KEGG   Homo sapiens (human): 728498Help
Entry
728498            CDS       T01001                                 

Gene name
GOLGA8H, GOLGA6L11
Definition
(RefSeq) golgin A8 family member H
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GOLGA2L5 Nup54_57_C DUF218 Golgin_A5
Motif
Other DBs
NCBI-GeneID: 728498
NCBI-ProteinID: NP_001269419
HGNC: 37443
Ensembl: ENSG00000261794
Vega: OTTHUMG00000175654
Pharos: P0CJ92(Tdark)
UniProt: P0CJ92
Position
15q13.2
AA seq 632 aa AA seqDB search
MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSVPEKATSGGCQPPGDSATG
FHREGPTSSATLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKA
NNKKQKAKRVLEVQIQTLNIQKGKLNTDLYHMKRSLRYFEEKSKDLAVCLQHSLQRKGEL
ESVLSNVMATQKKKANQLSSRSKARTEWKLEQSMREEALLKVQLTQLKESFQQVQLERDE
CAEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKLERSLSKLKNQMAEPLPPEPP
AVPSEVELQHLRKELERVAGELQAQVKKNQRISLLNQRQEERIQEQEERLRKQEERIQEQ
HKSLQQLAKPQSVFEEPNNENKNALQLEQQVKELQEKLGEEHLEAASQQNQQLTAQLSLM
ALPGEGHGGEHLDSEGEEAPRPMPSVPEDPESREAMSSFMDHLEEKADLSELVKKKELCF
IHHWRDRCHQKTHHLLSEPGGRAKDAALGGGHHQAGAQGGDEGEAAGAAADGIAAYSNYN
NGHRKFLAAAHNSADEPGPGAPAPQELGAADKHGDLCEVSLTSSAQGEAREDPLLDKPTA
QPIVQDHQEHPGLGSNCCVPLLCWAWLPRRRR
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaactcaacacaacaaattggctgcagccaagaaaaagttaaaagaatat
tggcagaaaaacagccctagagttccagcaggagcgaacaggaacaggaaaacaaatggc
agtgtccctgagaaagccacttctggtggttgccagccacctggggattcagcaacaggt
ttccacagggaaggccctacatcatctgctaccctgaaagatctggagagcccgtgccaa
gaacgagcagtagtcctggattcaaggtccgtagaaatcagtcaactgaagaacaccatc
aaatctctgaaacaacagaagaaacaagtggaacatcagctggaagaagaaaagaaagca
aacaacaagaaacagaaagccaaaagggtgctagaggttcaaatccagacattgaacata
cagaaagggaaactaaatacggacctgtaccacatgaaacgttctctcagatactttgaa
gaaaagtccaaggatctggctgtctgcctgcaacattcattgcagcgtaaaggagagtta
gagagtgttctctctaatgtcatggccacacagaagaagaaggcaaaccagttgtccagc
cgcagcaaagcacgtacggagtggaagttagagcagtccatgcgggaggaggcactactg
aaagtgcagctgacacagttgaaggagtcatttcaacaagtccaattagaaagagatgag
tgtgctgaacatctaaaaggagagagggcccggtggcagcagaggatgagaaaaatgtcg
caggagatttgcacattaaagaaagagaagcagcaagatatgcgtcgggtagagaagctg
gagaggagcttgtccaaactcaaaaaccagatggctgaacccttgcccccggagccccca
gcagtgccctctgaggtggagctgcagcacctgaggaaggaactagagagagtggcagga
gagctccaggcccaggtcaaaaagaatcagcgcataagtctcctgaaccagcgacaagaa
gagaggattcaggagcaggaagagaggcttcggaagcaggaggagaggattcaggagcag
cacaagagccttcagcagctggccaagccacagagcgtcttcgaggagccgaacaatgag
aacaagaacgcactgcagttggagcagcaagtaaaggagctacaggagaagcttggcgag
gagcacctggaagctgccagccagcagaaccagcagctaacggcccagctgagcctcatg
gctctccctggggaaggacacggaggagaacatctggacagtgagggggaggaggcacct
cggcccatgccgagtgtcccagaggacccggagagcagggaggccatgagcagctttatg
gaccacctggaggagaaggcagacctgagtgagctggtgaagaaaaaagaactctgcttc
atccaccactggcgagacagatgccatcagaaaacccatcaccttttatcagaaccaggg
ggccgtgccaaagatgcggcactgggaggaggacaccatcaggctggagctcagggagga
gatgaaggtgaagctgctggagctgcagcagatggtattgcggcttacagcaactacaac
aatgggcacagaaaattcctggccgctgcccacaactctgctgatgagcccggtccagga
gccccagccccccaggagcttggggctgcagacaagcatggtgatctttgtgaggtgagc
ctcacctcctctgcccaaggagaggccagggaggatcctctccttgacaagcctactgca
cagccgatcgtgcaggaccaccaggagcacccaggcttgggcagcaactgctgtgtgcca
ttgttgtgctgggcttggctgccaagaagaaggagataa

DBGET integrated database retrieval system