KEGG   Homo sapiens (human): 728642Help
Entry
728642            CDS       T01001                                 

Gene name
CDK11A, CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, PITSLRE, p58GTA
Definition
(RefSeq) cyclin dependent kinase 11A
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    728642 (CDK11A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    728642 (CDK11A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     728642 (CDK11A)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   728642 (CDK11A)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    728642 (CDK11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 728642
NCBI-ProteinID: NP_001300825
OMIM: 116951
HGNC: 1730
Ensembl: ENSG00000008128
Vega: OTTHUMG00000000703
Pharos: Q9UQ88(Tbio)
UniProt: Q9UQ88
Position
1p36.33
AA seq 783 aa AA seqDB search
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHE
RRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQK
ERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPG
EARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEE
EEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEERENENHLLVV
PESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGC
RSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKA
QHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKH
LHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA
KEYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEKIWPGYSELPVVK
KMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDP
SMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFS
LKF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgaaaaggactcttggaaagtgaaaactttagatgaaattcttcaggaaaag
aaacgaaggaaggaacaagaggagaaagcagagataaaacgcttaaaaaattctgatgac
cgggattccaagcgggattcccttgaggagggggagctgagagatcactgcatggagatc
acaataaggaactccccgtatagaagagaagactcaatggaagacagaggagaagaagat
gattctttggccatcaaaccaccccagcaaatgtctcggaaagaaaaagttcatcacaga
aaagatgaaaagagaaaagaaaaatggaagcatgctagagtgaaagaaagagagcacgaa
cgtcggaaacgacatcgagaagaacaggataaagctcgccgggaatgggaaagacagaag
agaagggaaatggcaagggagcattccaggagagaaagggaccgcttggagcagttagaa
aggaagcgggagcgggagcgcaagatgcgggagcagcagaaggagcagcgggagcagaag
gagcgcgagcggcgggcggaggagcggcgcaaggagcgggaggcccgcagggaagtgtct
gcacatcaccgaacgatgagagaggactacagcgacaaagtgaaagccagccactggagt
cgcagcccgcctcggccgccgcgggagcggttcgagttgggagacggccggaagccaggt
gaggccaggccggcgcctgcgcagaagccagcacagttaaaagaagagaaaatggaagaa
agggacctgctgtccgacttacaggacatcagcgacagcgagaggaagaccagctcggcc
gagtcctcgtcagcggaatcaggctcaggttctgaggaagaagaggaggaggaggaagag
gaggaggaggaagggagcaccagtgaagaatcagaggaggaggaggaggaagaggaagag
gaggaggaggagaccggcagcaactctgaggaggcatcagagcagtctgccgaagaagta
agtgaggaagaaatgagtgaagatgaagaacgagaaaatgaaaaccacctcttggttgtt
ccagagtcacggttcgaccgagattccggggagagtgaagaagcagaggaagaagtgggt
gagggaacgccgcagagcagcgccctgacagagggcgactatgtgcccgactcccctgcc
ctgttgcccatcgagctcaagcaggagctgcccaagtacctgccggccctgcagggctgc
cggagcgtcgaggagttccagtgcctgaacaggatcgaggagggcacctatggagtggtc
tacagagcaaaagacaagaaaacagatgaaattgtggctctaaagcggctgaagatggag
aaggagaaggagggcttcccgatcacgtccctgagggagatcaacaccatcctcaaggcc
cagcatcccaacattgtcaccgttagagagattgtggtgggcagcaacatggacaagatc
tacatcgtgatgaactacgtggagcacgacctcaagagcctgatggagaccatgaaacag
cccttcctgccaggggaggtgaagaccctgatgatccagctgctgcggggggtgaaacac
ctgcacgacaactggatcctgcaccgtgacctcaagacgtccaacctgctgctgagccac
gccggcatcctcaaggtgggtgattttgggctggcgcgggagtacggatcccctctgaag
gcctacaccccggtcgtggtgacccagtggtaccgcgccccagagctgctgcttggtgcc
aaggaatactccacggccgtggacatgtggtcagtgggctgcatcttcggggagctgctg
actcagaagcctctgttccccgggaattcggaaatcgatcagatcaacaaagtgttcaag
gagctggggacccccagtgagaaaatctggcccggctacagtgagctcccagtagtcaaa
aagatgaccttcagcgagcacccctacaacaacctccgcaagcgcttcggggctctgctc
tcagaccagggcttcgacctcatgaacaagttcctgacctacttccccgggaggaggatc
agcgctgaggacggcctcaagcatgagtatttccgcgagacccccctccccatcgacccc
tccatgttccccacgtggcccgccaagagcgagcagcagcgtgtgaagcggggcaccagc
ccgaggccccctgagggaggcctgggctacagccagctgggtgacgacgacctgaaggag
acgggcttccaccttaccaccacgaaccagggggcctctgccgcgggccccggcttcagc
ctcaagttctga

DBGET integrated database retrieval system