KEGG   Homo sapiens (human): 728689Help
Entry
728689            CDS       T01001                                 

Gene name
EIF3CL
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C like
  KO
K03252  translation initiation factor 3 subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    728689 (EIF3CL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    728689 (EIF3CL)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    728689 (EIF3CL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 728689
NCBI-ProteinID: NP_001093131
HGNC: 26347
Ensembl: ENSG00000205609
Vega: OTTHUMG00000097025
Pharos: B5ME19(Tdark)
UniProt: B5ME19
Structure
PDB: 

Position
16p12.1
AA seq 914 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEG
SSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEEDNEGG
EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQ
IAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIF
VGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQV
CAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAEN
EGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQ
HADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERN
QEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLR
VGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTML
VRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPT
QTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYM
RRGGYRQQQSQTAY
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtttttcaccaccggttcggacagcgagtccgagtcgtccttgtccggggag
gagctcgtcaccaaacctgtcggaggcaactatggcaaacagccattgttgctgagcgag
gatgaagaagataccaagagagttgtccgcagtgccaaggacaagaggtttgaggagctg
accaaccttatccggaccatccgtaatgccatgaagattcgtgatgtcaccaagtgcctg
gaagagtttgagctcctgggaaaagcatatgggaaggccaaaagcattgtggacaaagaa
ggtgtcccccggttctatatccgcatcctggctgacctagaggactatcttaatgagctt
tgggaagataaggaagggaagaagaagatgaacaagaacaatgccaaggctctgagcacc
ttgcgtcagaagatccgaaaatacaaccgtgatttcgagtcccatatcacaagctacaag
cagaaccccgagcagtctgcggatgaagatgctgagaaaaatgaggaggattcagaaggc
tcttcagatgaggatgaggatgaggacggagtcagtgctgcaactttcttgaagaagaaa
tcagaagctccttctggggagagtcgcaagttcctcaaaaagatggatgatgaagatgag
gactcagaagattccgaagatgatgaagactgggacacaggttccacatcttccgattcc
gactcagaggaggaagaagggaaacaaaccgcgctggcctcaagatttcttaaaaaggca
cccaccacagatgaggacaagaaggcagccgagaagaaacgggaggacaaagctaagaag
aagcacgacaggaaatccaagcgcctggatgaggaggaggaggaggacaatgaaggcggg
gagtgggaaagggtccggggcggagtgccgttggttaaggagaagccaaaaatgtttgcc
aagggaactgagatcacccatgctgttgttatcaagaaactgaatgagatcctacaggca
cgaggcaagaagggaactgatcgtgctgcccagattgagctgctgcaactgctggttcag
attgcagcggaaaacaacctgggagagggcgtcattgtcaagatcaagttcaatatcatc
gcctctctctatgactacaaccccaacctggcaacctacatgaagccagagatgtggggg
aagtgcctggactgcatcaatgagctgatggatatcctgtttgcaaatcccaacattttt
gttggagagaatattctggaagagagtgagaacctgcacaacgctgaccagccactgcgt
gtccgtggctgcatcctaactctggtggaacgaatggatgaagaatttaccaaaataatg
caaaatactgaccctcactcccaagagtacgtggagcacttgaaggatgaggcccaggtg
tgtgccatcatcgagcgtgtgcagcgctacctggaggagaagggcactaccgaggaggtc
tgccgcatctacctgctgcgcatcctgcacacctactacaagtttgattacaaggcccat
cagcgacagctgaccccgcctgagggctcctcaaagtctgagcaagaccaggcagaaaat
gagggcgaggactcggctgtgttgatggagagactgtgcaagtacatctacgccaaggac
cgcacagaccggatccgcacatgtgccatcctctgccacatctaccaccatgctctgcac
tcgcgctggtaccaggcccgcgacctcatgctcatgagccacttgcaggacaacattcag
catgcagacccgccagtgcagatcctttacaaccgcaccatggtgcagctgggcatctgt
gccttccgccaaggcctgaccaaggacgcacacaacgccctgctggacatccagtcgagt
ggccgagccaaggagcttctgggccagggcctgctgctgcgcagcctgcaggagcgcaac
caggagcaggagaaggtggagcggcgccgtcaggtccccttccacctgcacatcaacctg
gagctgctggagtgtgtctacctggtgtctgccatgctcctggagatcccctacatggcc
gcccatgagagcgatgcccgccgacgcatgatcagcaagcagttccaccaccagctgcgc
gtgggcgagcgacagcccctgctgggtccccctgagtccatgcgggaacatgtggtcgct
gcctccaaggccatgaagatgggtgactggaagacctgtcacagttttatcatcaatgag
aagatgaatgggaaagtgtgggaccttttccccgaggctgacaaagtccgcaccatgctg
gttaggaagatccaggaagagtcactgaggacctacctcttcacctacagcagtgtctat
gactccatcagcatggagacgctgtcagacatgtttgagctggatctgcccactgtgcac
tccatcatcagcaaaatgatcattaatgaggagctgatggcctccctggaccagccaaca
cagacagtggtgatgcaccgcactgagcccactgcccagcagaacctggctctgcagctg
gccgagaagctgggcagcctggtggagaacaacgaacgggtgtttgaccacaagcagggc
acctacgggggctacttccgagaccagaaggacggctaccgcaaaaacgagggctacatg
cgccgcggtggctaccgccagcagcagtctcagacggcctactga

DBGET integrated database retrieval system