KEGG   Homo sapiens (human): 728695
Entry
728695            CDS       T01001                                 

Gene name
SPANXB1, B1, CT11.2, SPANX-B, SPANXB, SPANXB2, SPANXF1, SPANXF2
Definition
(RefSeq) SPANX family member B1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SPAN-X
Other DBs
NCBI-GeneID: 728695
NCBI-ProteinID: NP_115850
OMIM: 300669
HGNC: 14329
Ensembl: ENSG00000227234
Vega: OTTHUMG00000022554
Pharos: Q9NS25(Tbio)
UniProt: Q9NS25
Position
Xq27.1
AA seq 103 aa
MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVR
YRRNVKRTSPEELLNDHARENRINPDQMEEEEFIEITTERPKK
NT seq 312 nt   +upstreamnt  +downstreamnt
atgggccaacaatccagtgtccgcaggctgaagaggagcgtcccctgtgaatccaacgag
gccaacgaggccaatgaggccaacaagacgatgccggagaccccaactggggactcagac
ccgcaacctgctcctaaaaaaatgaaaacatctgagtcctcgaccatactagtggttcgc
tacaggaggaacgtgaaaagaacatctccagaggaactgctgaatgaccacgcccgagag
aacagaatcaaccccgaccaaatggaggaggaggaattcatagaaataacgactgaaaga
cctaaaaagtag

DBGET integrated database retrieval system