KEGG   Homo sapiens (human): 7288
Entry
7288              CDS       T01001                                 

Gene name
TULP2, CT65, TUBL2
Definition
(RefSeq) TUB like protein 2
  KO
K19600  tubby and related proteins
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    7288 (TULP2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Tubby family proteins
   7288 (TULP2)
SSDB
Motif
Pfam: Tub Tub_N DUF3527
Other DBs
NCBI-GeneID: 7288
NCBI-ProteinID: NP_003314
OMIM: 602309
HGNC: 12424
Ensembl: ENSG00000104804
Vega: OTTHUMG00000164406
Pharos: O00295(Tdark)
UniProt: O00295
Position
19q13.33
AA seq 520 aa
MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSC
LREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRN
LGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESD
SQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSK
ALKGEGGTDSDHMRHEASLAIRSPCPGLEEDMEAYVLRPALPGTMMQCYLTRDKHGVDKG
LFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFVGKVRSNVFST
KFTIFDNGVNPDREHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRIN
VQPLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDP
KHQEHLVLQFGRVGPDTFTMDFCFPFSPLQAFSICLSSFN
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtctcaggataatgacacattgatgagagacatcctggggcatgagctcgctgctatg
aggctgcagaagctggaacagcagcggcggctgtttgaaaagaagcagcgacagaagcgc
caggagctcctcatggttcaggccaatcctgacgcttccccgtggctttggcgctcttgt
ctgcgggaggagcgccttttaggtgacagaggccttgggaaccctttcctccggaagaaa
gtgtcagaggcacatctgccctctggcatccacagtgccctgggcaccgtgagctgtggt
ggagacggcaggggcgagcgcggcctcccgacaccgcggacagaagcagtgttcaggaat
ctcggtctccagtcccctttcttatcctggctcccagacaattccgatgcagaattggag
gaagtctccgtggagaatggttccgtctctcccccaccttttaaacagtctccgagaatc
cgacgcaagggttggcaagcccaccaacgacctgggacccgtgcagagggtgagagtgac
tcccaggatatgggagatgcacacaagtcacccaatatgggaccaaaccctggaatggat
ggtgactgtgtatatgaaaacttggccttccaaaaggaagaagacttggaaaagaagaga
gaggcctctgagtctacagggacgaactcctcagcagcacacaacgaagagttgtccaag
gccctgaaaggcgagggtggcacggacagcgaccatatgaggcacgaagcctccttggca
atccgctccccctgccctgggctggaggaggacatggaagcctacgtgctgcggccagcg
ctcccgggcaccatgatgcagtgctacctcacccgtgacaagcacggcgtggacaagggc
ttgttccccctctactacctctacctggagacctctgacagcctgcagcgcttcctcctg
gctgggcgaaagagaagaaggagcaaaacttctaattacctcatctccctggatcctaca
cacctatctcgggacggggacaatttcgtgggcaaagtcagatccaatgtcttcagcacc
aagttcaccatctttgacaatggggtgaatcctgaccgggagcatttaaccaggaatact
gcccggatcagacaggagctgggggctgtgtgttatgagcccaacgtcttaggatacctg
gggcctcggaaaatgactgtgattctcccaggaaccaacagccagaaccagcgaatcaat
gtccagccactaaatgaacaggagtcgctactgagtcgttaccaacgtggggacaaacaa
gggttgcttttgttgcacaacaaaaccccgtcgtgggacaaggagaacggtgtctacacg
ctcaatttccatggtcgagtcactcgggcttcggtgaagaacttccaaatcgtggatccc
aaacaccaagaacatctggtgctccagttcggccgagtgggcccagacacattcaccatg
gacttctgctttccatttagcccgctccaggccttcagcatctgcttgtccagtttcaat
tag

DBGET integrated database retrieval system