KEGG   Homo sapiens (human): 729025Help
Entry
729025            CDS       T01001                                 

Gene name
SLC15A5
Definition
(RefSeq) solute carrier family 15 member 5
  KO
K14639  solute carrier family 15, member 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    729025 (SLC15A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   729025 (SLC15A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTR2
Motif
Other DBs
NCBI-GeneID: 729025
NCBI-ProteinID: NP_001164269
HGNC: 33455
Ensembl: ENSG00000188991
Vega: OTTHUMG00000168793
Pharos: A6NIM6(Tdark)
UniProt: A6NIM6
Position
12p12.3
AA seq 579 aa AA seqDB search
MSVTGFTITDEKVHLYHSIEKEKTVRHIGDLCSSHSVKKIQVGICLLLVELCERFTFFEV
VCNMIPFCTIKLGYHNCQAAILNLCFIGTSILTPVFVRWLTDVYLGRNKLVYICLFLHFL
GTALLSVVAFPLEDFYLGTYHAVNNIPKTEQHRLFYVALLTICLGIGGVRAIVCPLGAFG
LQEYGSQKTMSFFNWFYWLMNLNATIVFLGISYIQHSQAWALVLLIPFMSMLMAVITLHM
IYYNLIYQSEKRCSLLTGVGVLVSALKTCHPQYCHLGRDVTSQLDHAKEKNGGCYSELHV
EDTTFFLTLLPLFIFQLLYRMCIMQIPSGYYLQTMNSNLNLDGFLLPIAVMNAISSLPLL
ILAPFLEYFSTCLFPSKRVGSFLSTCIIAGNLFAALSVMIAGFFEIHRKHFPAVEQPLSG
KVLTVSSMPCFYLILQYVLLGVAETLVNPALSVISYRFVPSNVRGTSMNFLTLFNGFGCF
TGALLVKLVYLISDGNWFPNTLNKGNLESFFFFLASLTLLNVLGFCSVSQRYCNLNHFNA
QNIRGSNLEETLLLHEKSLKFYGSIQEFSSSIDLWETAL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttacaggctttaccataactgatgagaaagtacacttatatcacagcattgag
aaggagaaaactgtaagacatattggcgatttgtgttcctcacactctgtgaaaaaaatt
caggttggaatctgcttgcttctggtggagctgtgtgagaggttcacgttctttgaagtc
gtctgcaacatgatccccttttgcactatcaagcttggctatcacaattgccaagcagcc
atcttaaacttgtgttttattggaacttcaatacttacccctgtgtttgtcagatggctc
actgatgtctatttaggaagaaacaaactggtgtacatttgcttgtttctacattttcta
ggcactgctttgttatctgtggtggcttttcccttggaagatttctatctgggcacttac
catgcagttaacaacataccaaaaacagagcagcacaggctgttttatgtagcactgctg
accatttgccttggcattggaggcgtaagagccatcgtctgtccactgggtgcttttggc
cttcaggagtatggatcacaaaaaacgatgtctttttttaactggttttattggctcatg
aacctaaatgcaactattgtgtttctgggaatatcttacatccagcactcacaggcctgg
gcccttgttttacttattccttttatgtctatgcttatggctgtgataactcttcatatg
atatactacaacctaatttatcagtcagaaaaacgttgttctctcctgacaggcgttggg
gtgttggttagtgcactgaaaacatgccacccgcaatactgccatcttggcagagacgtg
acaagccagttagaccatgccaaagaaaaaaatggtggctgctacagtgagctccatgta
gaagacacaacatttttcctcacccttctccctctcttcatttttcagctcctatacaga
atgtgcattatgcagattccttcaggatattatctgcaaactatgaattccaacctgaat
ttggatggatttcttctgccgattgcagtaatgaatgccatcagcagcctaccattacta
attctggctccttttctggagtatttcagcacctgcctgtttccctctaagagagttgga
tcatttctgtcaacatgcatcattgctggaaatctttttgctgcattgtctgtgatgata
gctggcttctttgaaatacaccgaaaacatttccctgcagtggagcagcccctttcagga
aaagttctcactgtttcctccatgccctgtttctacctgattcttcagtatgttttactt
ggagtggcggaaacactggtaaacccagccctctctgtaatatcatacagatttgttcca
agcaatgtcagaggaacctccatgaattttctgacactgttcaatggatttggctgtttc
acaggggcactgctggtgaagttggtatatctcatctcagatggcaattggtttccaaac
acattaaacaaaggcaatttagaaagcttcttcttcttcctggcatcattaacattgttg
aacgtcctgggattctgcagtgtttcacaaagatattgtaatctaaatcattttaatgcc
cagaacatccgtggaagtaatcttgaagaaacacttctcctccacgaaaaatctctgaaa
ttttatggcagtatacaggaattttcttcaagtattgatctttgggagacagccctatga

DBGET integrated database retrieval system