KEGG   Homo sapiens (human): 7292Help
Entry
7292              CDS       T01001                                 

Gene name
TNFSF4, CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1
Definition
(RefSeq) TNF superfamily member 4
  KO
K05469  tumor necrosis factor ligand superfamily member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H01492  Systemic sclerosis
Drug target
Oxelumab: D09943
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7292 (TNFSF4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   7292 (TNFSF4)
CD molecules [BR:hsa04090]
 Proteins
  7292 (TNFSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nit_Regul_Hom
Motif
Other DBs
NCBI-GeneID: 7292
NCBI-ProteinID: NP_003317
OMIM: 603594
HGNC: 11934
Ensembl: ENSG00000117586
Vega: OTTHUMG00000034838
Pharos: P23510(Tbio)
UniProt: P23510 A0A024R937
Structure
PDB: 

Position
1q25.1
AA seq 183 aa AA seqDB search
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
CVL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtccaacccctggaagagaatgtgggaaatgcagccaggccaagattcgag
aggaacaagctattgctggtggcctctgtaattcagggactggggctgctcctgtgcttc
acctacatctgcctgcacttctctgctcttcaggtatcacatcggtatcctcgaattcaa
agtatcaaagtacaatttaccgaatataagaaggagaaaggtttcatcctcacttcccaa
aaggaggatgaaatcatgaaggtgcagaacaactcagtcatcatcaactgtgatgggttt
tatctcatctccctgaagggctacttctcccaggaagtcaacattagccttcattaccag
aaggatgaggagcccctcttccaactgaagaaggtcaggtctgtcaactccttgatggtg
gcctctctgacttacaaagacaaagtctacttgaatgtgaccactgacaatacctccctg
gatgacttccatgtgaatggcggagaactgattcttatccatcaaaatcctggtgaattc
tgtgtcctttga

DBGET integrated database retrieval system