KEGG   Homo sapiens (human): 729230Help
Entry
729230            CDS       T01001                                 

Gene name
CCR2, CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Definition
(RefSeq) C-C motif chemokine receptor 2
  KO
K04177  C-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Network
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
Disease
H01360  Allergic rhinitis
Drug target
Cenicriviroc (DG01264): D09878 D09879
Plozalizumab: D10972
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    729230 (CCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    729230 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    729230 (CCR2)
   04050 Cytokine receptors [BR:hsa04050]
    729230 (CCR2)
   04090 CD Molecules [BR:hsa04090]
    729230 (CCR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    729230 (CCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   729230 (CCR2)
CD molecules [BR:hsa04090]
 Proteins
  729230 (CCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab
Motif
Other DBs
NCBI-GeneID: 729230
NCBI-ProteinID: NP_001116513
OMIM: 601267
HGNC: 1603
Ensembl: ENSG00000121807
Vega: OTTHUMG00000156466
Pharos: P41597(Tchem)
UniProt: P41597
Position
3p21.31
AA seq 374 aa AA seqDB search
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccacatctcgttctcggtttatcagaaataccaacgagagcggtgaagaagtc
accaccttttttgattatgattacggtgctccctgtcataaatttgacgtgaagcaaatt
ggggcccaactcctgcctccgctctactcgctggtgttcatctttggttttgtgggcaac
atgctggtcgtcctcatcttaataaactgcaaaaagctgaagtgcttgactgacatttac
ctgctcaacctggccatctctgatctgctttttcttattactctcccattgtgggctcac
tctgctgcaaatgagtgggtctttgggaatgcaatgtgcaaattattcacagggctgtat
cacatcggttattttggcggaatcttcttcatcatcctcctgacaatcgatagatacctg
gctattgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgaca
agtgtgatcacctggttggtggctgtgtttgcttctgtcccaggaatcatctttactaaa
tgccagaaagaagattctgtttatgtctgtggcccttattttccacgaggatggaataat
ttccacacaataatgaggaacattttggggctggtcctgccgctgctcatcatggtcatc
tgctactcgggaatcctgaaaaccctgcttcggtgtcgaaacgagaagaagaggcatagg
gcagtgagagtcatcttcaccatcatgattgtttactttctcttctggactccctataat
attgtcattctcctgaacaccttccaggaattcttcggcctgagtaactgtgaaagcacc
agtcaactggaccaagccacgcaggtgacagagactcttgggatgactcactgctgcatc
aatcccatcatctatgccttcgttggggagaagttcagaagcctttttcacatagctctt
ggctgtaggattgccccactccaaaaaccagtgtgtggaggtccaggagtgagaccagga
aagaatgtgaaagtgactacacaaggactcctcgatggtcgtggaaaaggaaagtcaatt
ggcagagcccctgaagccagtcttcaggacaaagaaggagcctag

DBGET integrated database retrieval system