KEGG   Homo sapiens (human): 729230Help
Entry
729230            CDS       T01001                                 

Gene name
CCR2, CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Definition
(RefSeq) C-C motif chemokine receptor 2
  KO
K04177  C-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
Disease
H01360  Allergic rhinitis
Drug target
Cenicriviroc (DG01264): D09878 D09879
Plozalizumab: D10972
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    729230 (CCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    729230 (CCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    729230 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    729230 (CCR2)
   04050 Cytokine receptors [BR:hsa04050]
    729230 (CCR2)
   04090 CD molecules [BR:hsa04090]
    729230 (CCR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    729230 (CCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   729230 (CCR2)
CD molecules [BR:hsa04090]
 Proteins
  729230 (CCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab
Motif
Other DBs
NCBI-GeneID: 729230
NCBI-ProteinID: NP_001116513
OMIM: 601267
HGNC: 1603
Ensembl: ENSG00000121807
Vega: OTTHUMG00000156466
Pharos: P41597(Tchem)
UniProt: P41597
Position
3p21.31
AA seq 374 aa AA seqDB search
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccacatctcgttctcggtttatcagaaataccaacgagagcggtgaagaagtc
accaccttttttgattatgattacggtgctccctgtcataaatttgacgtgaagcaaatt
ggggcccaactcctgcctccgctctactcgctggtgttcatctttggttttgtgggcaac
atgctggtcgtcctcatcttaataaactgcaaaaagctgaagtgcttgactgacatttac
ctgctcaacctggccatctctgatctgctttttcttattactctcccattgtgggctcac
tctgctgcaaatgagtgggtctttgggaatgcaatgtgcaaattattcacagggctgtat
cacatcggttattttggcggaatcttcttcatcatcctcctgacaatcgatagatacctg
gctattgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgaca
agtgtgatcacctggttggtggctgtgtttgcttctgtcccaggaatcatctttactaaa
tgccagaaagaagattctgtttatgtctgtggcccttattttccacgaggatggaataat
ttccacacaataatgaggaacattttggggctggtcctgccgctgctcatcatggtcatc
tgctactcgggaatcctgaaaaccctgcttcggtgtcgaaacgagaagaagaggcatagg
gcagtgagagtcatcttcaccatcatgattgtttactttctcttctggactccctataat
attgtcattctcctgaacaccttccaggaattcttcggcctgagtaactgtgaaagcacc
agtcaactggaccaagccacgcaggtgacagagactcttgggatgactcactgctgcatc
aatcccatcatctatgccttcgttggggagaagttcagaagcctttttcacatagctctt
ggctgtaggattgccccactccaaaaaccagtgtgtggaggtccaggagtgagaccagga
aagaatgtgaaagtgactacacaaggactcctcgatggtcgtggaaaaggaaagtcaatt
ggcagagcccctgaagccagtcttcaggacaaagaaggagcctag

DBGET integrated database retrieval system