KEGG   Homo sapiens (human): 7294Help
Entry
7294              CDS       T01001                                 

Gene name
TXK, BTKL, PSCTK5, PTK4, RLK, TKL
Definition
(RefSeq) TXK tyrosine kinase
  KO
K08016  tyrosine-protein kinase TXK [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7294 (TXK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7294 (TXK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7294 (TXK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  TEC family
   7294 (TXK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10
Motif
Other DBs
NCBI-GeneID: 7294
NCBI-ProteinID: NP_003319
OMIM: 600058
HGNC: 12434
Ensembl: ENSG00000074966
Vega: OTTHUMG00000102065
Pharos: P42681(Tchem)
UniProt: P42681
Structure
PDB: 

Position
4p12
AA seq 527 aa AA seqDB search
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgatcctttcctcctataacaccatccagtcggttttctgttgctgctgttgctgttca
gtgcagaagcgacaaatgagaacacagataagcctgagcacagatgaagagcttccagaa
aaatacacccagcgtcgcaggccgtggctcagccaattgtcaaataagaagcaatccaac
acgggccgtgtgcagccgtcaaaacgaaagccactgcctcccctcccaccctctgaggtt
gctgaagagaagatccaagtcaaggcactttatgattttctgcccagagaaccctgtaat
ttagccttaaggagagcagaagaatacctgatactggagaaatacaatcctcactggtgg
aaggcaagagaccgtttggggaatgaaggcttaatcccaagcaactatgtgactgaaaac
aaaataactaatttagaaatatatgagtggtaccatagaaacattaccagaaatcaggca
gaacatctattgagacaagagtctaaagaaggtgcatttattgtcagagattcaagacat
ttaggatcctacacaatttccgtatttatgggagctagaagaagtacggaggctgccata
aaacattatcagataaaaaagaatgactcaggacagtggtatgtggctgaaagacacgcc
tttcaatcaatccctgagttaatctggtatcaccagcacaatgcagccggtctcatgact
cgtctccgatatccagttgggctgatgggcagttgtttaccagccacagctgggtttagc
tacgaaaagtgggagatagatccatctgagttggcttttataaaggagattggaagcggt
cagtttggagtggtccatttaggtgaatggcggtcacatatccaggtagctatcaaggcc
atcaatgaaggctccatgtctgaagaggatttcattgaagaggccaaagtgatgatgaaa
ttatctcattcaaagctagtgcaactttatggagtctgtatacagcggaagcccctttac
attgtgacagagttcatggaaaatggctgcctgcttaactatctcagggagaataaagga
aagcttaggaaggaaatgctactgagtgtatgccaggatatatgtgaaggaatggaatat
ctggagaggaatggctatattcatagggatttggcggcaaggaattgtttggtcagttca
acatgcatagtaaaaatttcagactttggaatgacaaggtacgttttggatgatgagtat
gtcagttcttttggagccaagttcccaatcaagtggtcccctcctgaagtttttcttttc
aataagtacagcagtaaatctgatgtctggtcatttggagttttaatgtgggaagttttt
acagaaggaaaaatgccttttgaaaataagtcaaatttgcaagtcgtggaagctatttct
gaaggcttcaggctatatcgccctcacctggcaccaatgtccatatatgaagtcatgtac
agctgctggcatgagaaacctgaaggccgccctacatttgccgagctgctgcgggctgtc
acagagattgcggaaacctggtga

DBGET integrated database retrieval system