KEGG   Homo sapiens (human): 729438Help
Entry
729438            CDS       T01001                                 

Gene name
CASTOR2, GATSL1, GATSL2
Definition
(RefSeq) cytosolic arginine sensor for mTORC1 subunit 2
  KO
K23081  cytosolic arginine sensor for mTORC1 subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Drug target
Sapanisertib: D11183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    729438 (CASTOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACT_7 Castor1_N
Motif
Other DBs
NCBI-GeneID: 729438
NCBI-ProteinID: NP_001138536
OMIM: 617033
HGNC: 37073
Ensembl: ENSG00000274070
Vega: OTTHUMG00000181541
Pharos: A6NHX0(Tdark)
UniProt: A6NHX0
Position
7q11.23
AA seq 329 aa AA seqDB search
MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTRCKFFSLTETPEDYTIIVDEEGF
LELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTY
QTDFILVRERDLPFVTHTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLS
SPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISL
VMDVQTQQRFPSNLLFTSASGELWKMVRIGGQPLGFDECGIVAQISEPLAAADIPAYYIS
TFKFDHALVPEENINGVISALKVSQAEKH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaactccacatcctggagcaccggctgcaagttgccagcgtcgccaaggagagtatc
ccgctgttcacctacggcctgatcaaacttgccttcctgtcctccaagaccaggtgcaag
ttcttcagtctgactgagacgccagaggattacactatcattgtcgatgaggaaggattc
ctagagctgccctcctcggagcacctgagtgtggcagatgccacctggctggccctgaac
gtggtgtccggcggtggcagcttctccagctcccagcccatcggcgtgaccaagatcgcc
aagtcagtcatcgccccactggctgaccagaacatatccgtgttcatgctgtccacgtat
cagacagacttcatcctggtgcgcgagcgggacctgccctttgtcacccacacattgtca
tcagagttcaccatcctgcgggtcgtcaatggcgagaccgtggcagccgagaacctcggc
atcaccaatggcttcgtgaagcccaagctggtccagaggccagtcatccacccactgtcc
agcccgagcaacaggttctgtgtcaccagcctggaccctgacacgctgcctgctgttgcc
acactcctcatggatgtcatgttctactccaatggagtgaaggaccccatggccactggg
gatgactgcggccacatccgcttcttctccttctccctcatcgagggctacatctccctg
gtgatggacgtgcagacgcagcagaggtttcctagtaacttgctgttcacaagcgcatcc
ggagagctctggaagatggtccggattggaggacagcccctggggtttgatgagtgtggc
atcgtggcccagatctcagagcccttggctgctgcagacatcccagcctactacatcagt
actttcaagtttgatcatgcacttgtccccgaagagaacatcaatggtgtcatcagtgcc
ctgaaggtcagccaagcagagaagcactag

DBGET integrated database retrieval system