KEGG   Homo sapiens (human): 7297Help
Entry
7297              CDS       T01001                                 

Gene name
TYK2, IMD35, JTK1
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
Module
hsa_M00684  JAK-STAT signaling
Network
N00150  Type I IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
Disease
H00107  Other well-defined immunodeficiency syndromes
H01968  Hyper-IgE syndrome
Drug target
Tofacitinib (DG00742): D09783 D09970
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    7297 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7297 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7297 (TYK2)
   04658 Th1 and Th2 cell differentiation
    7297 (TYK2)
   04659 Th17 cell differentiation
    7297 (TYK2)
  09158 Development
   04380 Osteoclast differentiation
    7297 (TYK2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    7297 (TYK2)
   05164 Influenza A
    7297 (TYK2)
   05160 Hepatitis C
    7297 (TYK2)
   05168 Herpes simplex infection
    7297 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7297 (TYK2)
   05169 Epstein-Barr virus infection
    7297 (TYK2)
   05165 Human papillomavirus infection
    7297 (TYK2)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    7297 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7297 (TYK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7297 (TYK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   7297 (TYK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 7297
NCBI-ProteinID: NP_003322
OMIM: 176941
HGNC: 12440
Ensembl: ENSG00000105397
Vega: OTTHUMG00000166373
Pharos: P29597(Tclin)
UniProt: P29597 A0A024R7E4
Structure
PDB: 

Position
19p13.2
AA seq 1187 aa AA seqDB search
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgccactgggggatggccaggggcagtaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gagccctgggtcactttcagtgagtcatcgctgacagctgaggaagtctgcatccacatt
gcacataaagttggtatcactcctccttgcttcaatctctttgccctcttcgatgctcag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagatgcaagcctgatg
ctatatttccgcataaggttttatttccggaactggcatggcatgaatcctcgggaaccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcatgagttt
gtgaatgacgtggcatcactgtgggagctgtcgaccgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccgccatggcatc
cccctggaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctccttccgc
cggcatatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccgggccgactctcccagcagatggtcatggtcaaataccta
gccacactcgagcggctggcaccccgcttcggcacagagcgtgtgcccgtgtgccacctg
aggctgctggcccaggccgagggggagccctgctacatccgggacagtggggtggcccct
acagaccctggccctgagtctgctgctgggcccccaacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtagaggaggaggtgaacaaggaggagggttctagt
ggcagcagtggcaggaacccccaagccagcctgtttgggaagaaggccaaggctcacaag
gcagtcggccagccggcagacaggccgcgggagccactgtgggcctacttctgtgacttc
cgggacatcacccacgtggtgctgaaagagcactgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcttgccttcccgggctgcggcgctgtccttcgtgtcgctggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccgggatgggatccacggacccctgctggagccatttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcactggagcaccagccacccc
taccgcctgatcctcacagtggcccagcgtagccaggcaccagacggcatgcagagcttg
cggctccgaaagttccccattgagcagcaggacggggccttcgtgctggagggctggggc
cggtccttccccagcgttcgggaacttggggctgccttgcagggctgcttgctgagggcc
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaat
ctcatcatcatgcggggggctcgggccagccccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtatgagggccgcctgcgagtggagggcagcggggaccctgaggagggcaag
atggatgacgaggaccccctcgtgcctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggaccctagtcaccatgacatcgccctggccttctacgagacagccagc
ctcatgagccaggtctcccacacgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacggacccctggatgtgtggctgcgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcatggtaatgtgtgtggccggaacatc
ctgctggcccggctggggttggcagagggcaccagccccttcatcaagctgagtgatcct
ggcgtgggcctgggcgccctctccagggaggagcgggtggagaggatcccctggctggcc
cccgaatgcctaccaggtggggccaacagcctaagcaccgccatggacaagtgggggttt
ggcgccaccctcctggagatctgctttgacggagaggcccctctgcagagccgcagtccc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccacag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccatcattccgc
accatcctgcgtgacctcacccggctgcagccccacaatcttgctgacgtcttgactgtg
aacccggactcaccggcgtcggaccctacggttttccacaagcgctatttgaaaaagatc
cgagatctgggcgagggtcacttcggcaaggtcagcttgtactgctacgatccgaccaac
gacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggcccccagcac
cgctcgggctggaagcaggagattgacattctgcgcacgctctaccacgagcacatcatc
aagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtcatggagtac
gtgcccctgggcagcctccgagactacctgccccggcacagcatcgggctggcccagctg
ctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcagcactacatc
caccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtcaagatcggg
gactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtgcgcgaggat
ggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataagttctactat
gcgtcagatgtctggtccttcggggtgaccctgtatgagctgctgacgcactgtgactcc
agccagagcccccccacgaaattccttgagctcataggcattgctcagggtcagatgaca
gttctgagactcactgagttgctggaacgaggggagaggctgccacggcccgacaaatgt
ccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcctttcgccca
accttcgagaacctcatacccattctgaagacagtccatgagaagtaccaaggccaggcc
ccttcagtgttcagcgtgtgctga

DBGET integrated database retrieval system