KEGG   Homo sapiens (human): 729747Help
Entry
729747            CDS       T01001                                 

Gene name
ZNF878
Definition
(RefSeq) zinc finger protein 878
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    729747 (ZNF878)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    729747 (ZNF878)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    729747 (ZNF878)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 KRAB Zn-ribbon_8 DUF3268 zf-C2H2_11 zf-trcl Zn_ribbon_SprT C1_4 CpXC zf-met zinc_ribbon_15 zf-C2HE
Motif
Other DBs
NCBI-GeneID: 729747
NCBI-ProteinID: NP_001073873
HGNC: 37246
Ensembl: ENSG00000257446
Vega: OTTHUMG00000169370
Pharos: C9JN71(Tdark)
UniProt: C9JN71
Position
19p13.2
AA seq 531 aa AA seqDB search
MDSVAFEDVAVNFTQEEWALLDPSQKNLYREVMQETLRNLTSIGKKWNNQYIEDEHQNPR
RNLRRLIGERLSESKESHQHGEVLTQVPDDTLKKKTPGVQSYESSVCGEIGIGLSSLNRH
LRAFSYSSSLAIHGRTHTGEKPYECKECGKAFRFPSSVRRHERIHSAKKPYECKQCGKAF
SFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMHTGERPHKCNICGKAFFSPS
SLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEKPYECTQCRKAFRSVKYLRV
HERKHTGEKPYECKLCGKGFISSTSFRYHEKTHTGEKPYECKKCVKAFSFVKDLRIHERT
HTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCGKAFRSASVLQKHIRTHTGE
KPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKQCGKAFISSNSIRYHKRTHTGEKPYK
CKQCGKAFISSNSFLYHERIHTGEKPYECKQCGKAFRSASILQKHVRTHAG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggattcggtggcctttgaggatgtggctgtgaacttcacccaggaggagtgggctttg
ctggatccttcccagaaaaatctctacagggaagtgatgcaggaaaccttgaggaacctg
acctccataggaaaaaaatggaacaaccagtacattgaagatgagcaccaaaatcctagg
agaaacctaagaagacttataggggagagactctctgaaagtaaagaaagtcatcagcat
ggagaagttttgacacaggttccagatgacacactgaagaagaaaactcctggagtacaa
tcatatgaaagcagtgtgtgtggagaaatcggcataggtctttcatcccttaataggcac
ctcagagcctttagttattccagtagccttgcaatacatggaagaactcacactggggaa
aagccttatgaatgtaaggaatgtgggaaagcattcaggtttcccagttctgttcgtaga
catgaaagaatccactctgcaaaaaaaccctatgaatgtaagcagtgtgggaaagcattc
agttttcccagttctgttcgtagacatgaaagaatccactctgcaaaaaaaccctatgaa
tgtaagcagtgtgggaaagcattatcttatcttgtaagctttcagacacacatgagaatg
cacactggagagagacctcataaatgtaacatatgtgggaaagcctttttttctcccagt
tcgttaaaaagacacgagaaaagtcacactggagagaaacgctataaatgcaagcaatgt
gataaagccttcaattgtcccagttcctttcaatatcatgaaaggactcacagtggagag
aaaccctatgagtgtacacaatgtaggaaagccttcagatctgtcaagtacctgcgagta
catgaaagaaaacacactggagagaaaccctatgagtgtaagctatgtggtaagggattt
atttcttccacttcctttcgctatcatgaaaagactcacactggagagaaaccttatgaa
tgtaaaaaatgtgtgaaagccttcagttttgtcaaggatcttcgaatacatgaaaggaca
cacactggagagaaaccctttgaatgtaaacaatgtgggaaaaccttcacttcttccaat
tcctttcactatcatgaaaggactcacactggagagaaaccctatgagtgtaagcaatgt
gggaaagccttcagatctgcctcagtccttcaaaagcacatacgaactcacacaggagag
aaaccctatggatgtaagcaatgtggtaaagtctttagagttgcctcacaacttaaaatg
catgaaaggactcacacaggagagaaaccctatgagtgtaagcaatgtggaaaagccttc
atttcttctaattctattcgctatcataaaaggactcacactggagagaaaccctataaa
tgtaaacagtgtgggaaagccttcatttcttccaactcttttctctaccatgaaaggatt
catactggagagaaaccctatgagtgtaagcaatgtggtaaagcctttagatctgcctca
atccttcaaaagcatgtaaggactcacgctggctag

DBGET integrated database retrieval system