KEGG   Homo sapiens (human): 729857Help
Entry
729857            CDS       T01001                                 

Gene name
RGPD2, NUP358, RANBP2L2, RGP2
Definition
(RefSeq) RANBP2 like and GRIP domain containing 2
  KO
K24044   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ran_BP1 Rab_bind GRIP TPR_2 TPR_1 TPR_16 TPR_8 TPR_9 TPR_14 TPR_7 CENP-F_leu_zip TPR_11 DUF4790 TPR_12 HemX
Motif
Other DBs
NCBI-GeneID: 729857
NCBI-ProteinID: NP_001071638
OMIM: 612705
HGNC: 32415
Ensembl: ENSG00000185304
Vega: OTTHUMG00000153276
Pharos: P0DJD1(Tdark)
UniProt: P0DJD1 B4DYH0
Position
2p11.2
AA seq 1756 aa AA seqDB search
MRRSKAYGERYLASVQGSAPSPGKKLRGFYFAKLYYEAKEYDLAKKYVCTYLSVQERDPR
AHRFLGLLYELEENTEKAVECYRRSLELNPPQKDLVLKIAELLCKNDVTDGRAKYWVERA
AKLFPGSPAIYKLKEHLLDCEGEDGWNKLFDWIQSELYVRPDDVHMNIRLVELYRSNKRL
KDAVARCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYAN
LMLLTLSTRDVQESRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHGNNVQWQALSELAALCYVIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEVVETFANKSGQSVLYNALFSSQSSKDTSFLGSDDIGNIDVQEPELEDLA
RYDVGAIQAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKRLCTERQKSWWDAVCTLIH
RKAVPGNSAELRLVVQHEINTLRAQEKHGLQPALLVHWAKCLQKMGRGLNSSYDQQEYIG
RSVHYWKKVLPLLKIIKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAVH
GNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDAVFPEEQEECKNYLRKTRDYLIKI
IDDSDSNLSVVKKLPVPLESVKEMLKSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTPS
PTKYSLSPSKSYKYSPKTPPRWAEDQNSLRKMICQEVKAITKLNSSKSASRHRWPTENYG
PDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNTEFK
STKEGFSIAVSADGFKFGISEPGNQEKKSEKPLENDTGFQAQDISGQKNGRGVIFGQTSS
TFTFADVAKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQCGKMANKANTSGDFEKDDDAC
KTEDSDDIHFEPVVQMPEKVELVTGEEGEKVLYSQGVKLFRFDAEISQWKERGLGNLKIL
KNEVNGKPRMLMRRDQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLERLA
AQFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTF
LTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGPTLEWDNYDLREDALDDNVSSSSV
HDSPLASSPVRKNIFRFDESTTGFNFSFKSALSLSKSPAKLNQSGTSVGTDEESDVTQEE
ERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHMAELYRYDKDVGQWKERGIGDIKILQNY
DNKQVRIVMRRDQVLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKVEHLAVRF
KLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEETTRERTDVI
QGDDVADAASEVEVSSTSETTTKAVVSPPKFVFGSESVKRIFSSEKSNPFAFGNSSATGS
LFGFSFNAPLKSNDSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNLSASFPME
ESSINYTFKTPEKEPPLWHAEFTKEELVQKLSSTTKSADQLNGLLRETEATSAVLMEQIK
LLKSEIRRLERNQEESAANVEHLKNVLLQFIFLKPGSERESLLPVINTMLQLSPEEKGKL
AAVAQGLQETSIPKKK
NT seq 5271 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcagcaaagcctacggggagcggtacctcgcctcggtgcagggctccgccccg
tcgcctggaaagaagttgagaggattctattttgcaaagctgtattatgaagctaaagaa
tatgatcttgctaaaaaatacgtatgtacttaccttagtgtgcaagagagggatcccaga
gctcacagatttctgggtcttctttatgaattggaagaaaacacagagaaagccgttgaa
tgttacaggcgttcactggaattaaacccaccacaaaaagatcttgtgttgaagattgca
gaattgctttgtaaaaatgatgttactgatggaagagcaaaatactgggttgaaagggca
gcgaaacttttcccaggaagtcctgcaatttataaactaaaggaacatcttctagattgt
gaaggtgaagatggatggaataaactttttgactggattcagtcagaactttatgtaaga
cctgatgacgtccatatgaacatccggctagtggagttgtatcgctcaaataaaagattg
aaggatgctgtggcccgctgccatgaggcagagaggaacatagctttgcgttcaagttta
gagtggaattcgtgtgttgtacagacccttaaggaatatctggagtctttacagtgtttg
gagtctgataaaagtgactggcgagcaaccaatacagacttactgctggcctatgctaat
cttatgcttcttacgctttccactagagatgtgcaggaaagtagagaattactggaaagt
tttgatagtgctcttcagtctgcaaaatcttctttgggtggaaatgatgaactgtcagct
actttcttagaaatgaaaggacatttctacatgcatgctggttctctgctcttgaagatg
ggtcagcatggtaataatgttcaatggcaagctctttctgagctggctgcattgtgctat
gtcatagcatttcaggttccaagaccaaagattaaattaataaaaggtgaagctggacaa
aatctgctggaaatgatggcctgtgaccgactgagccaatcagggcatatgttgctaaac
ttaagtcgtggcaagcaagattttttaaaagaggttgttgaaacttttgccaacaaaagc
gggcagtctgtgttatataatgctctgttttctagtcagtcatctaaggatacatctttt
cttggtagcgatgatattggaaacattgatgtacaagaaccagagcttgaagatttggct
agatacgatgttggtgctattcaagcacataatggtagtcttcagcaccttacttggctt
ggcttacagtggaattcattgcctgctttacctggaatccgaaaatggctaaaacagctt
ttccatcatttgccccaggaaacctcaaggcttgaaacaaatgcacctgaatcaatatgt
attttagatcttgaagtatttctccttggagtagtatataccagccacttacaattaaag
gagaaatgtaattctcaccacagctcctatcagccgttatgcctgccccttcctgtgtgt
aaacggctttgtacagagagacaaaaatcttggtgggatgcggtttgtactctgattcac
agaaaagcagtacctggaaactcagcagaattgagacttgtagttcagcatgaaataaac
actctaagagcccaggaaaaacatggccttcaacctgctctgcttgtacattgggcaaaa
tgccttcagaaaatgggcaggggtcttaattcttcttatgatcaacaagaatacataggg
agaagtgttcattattggaagaaagttttgccattgttgaagataataaagaagaacagt
attcctgaacctattgatcctctgtttaaacattttcatagtgtagacattcaggcatca
gaaattgttgagtatgaagaagatgcacacataacttttgctatattggatgcagtacat
ggaaatatagaagatgctgtgactgcttttgaatctataaaaagtgttgtttcttattgg
aatcttgcactgatttttcacaggaaagcagaagacattgaaaatgatgccgtttttcct
gaagaacaagaagaatgcaaaaattatctgagaaagaccagggactacctaataaagatt
atagatgacagtgattcaaatctttcagtggtcaagaaattgcctgtgcccctggagtct
gtaaaagagatgcttaagtcagtcatgcaggaactcgaagactatagtgaaggaggtcct
ctctataaaaatggttctttgcgaaatgcagattcagaaataaaacattctacaccatct
cctaccaaatattcactatcaccaagtaaaagttacaagtattctcccaaaacaccacct
cgatgggcagaagatcagaattctttacggaaaatgatttgccaagaagtaaaggccatt
acgaaactaaatagcagtaagtcagcatcccgtcatcgttggcccacagagaattatgga
ccagactcggtgcctgatggatatcaggggtcacagacatttcatggggctccactaaca
gttgcaactactggcccttcagtatattatagtcagtcaccagcatataattcccagtat
cttctcagaccagcagctaatgttactcccacaaagggttcttctaatacagaatttaag
tcaaccaaagaaggattttccatcgctgtgtctgctgatggatttaaatttggcatttcg
gaaccaggaaatcaagaaaagaaaagtgaaaagcctcttgaaaatgatactggcttccag
gctcaggatattagtggccagaagaatggccgtggtgtgatttttggccaaacaagtagc
acttttacatttgcagatgttgcaaaatcaacttcaggagaaggatttcagtttggcaaa
aaagaccccaatttcaagggattttcaggtgctggagaaaaattattctcatcacaatgc
ggtaaaatggccaataaagcaaacacttccggtgactttgagaaagatgatgatgcctgt
aagactgaggacagcgatgacatccattttgaaccagtagttcaaatgcctgaaaaagta
gaacttgtaacaggagaagaaggtgaaaaagttctgtattcacagggggtaaaactattt
agatttgatgctgagataagtcagtggaaagaaaggggcttggggaacttaaaaattctc
aaaaatgaggtcaatggcaaaccaagaatgctgatgcgaagagaccaagtactaaaagtg
tgtgctaatcattggataacaactacaatgaacctgaagcccctctctggatcagataga
gcatggatgtggttagccagtgatttctctgatggtgatgccaaactagagcggttggca
gcacaatttaaaacaccagagctggctgaagaattcaagcagaaatttgaggaatgccag
cggcttctgttagacataccacttcaaactccccataaacttgtagatactggcagagct
gccaagctaatacagagagctgaagaaatgaagagtggactgaaagatttcaaaacgttt
ttgacaaatgatcaaacaaaagtcactgaggaagaaaataagggttcaggtacaggtgca
gccggtgcctcagacacaacaataaaacccaatcctgaaaacactgggcccacattagaa
tgggataactatgatttaagggaagatgctttggatgataatgttagtagtagctcagta
catgattctccgttggcaagtagccctgtgagaaaaaatattttccgctttgatgagtca
acaacaggatttaacttcagttttaaatctgctttgagtctatctaagtctcctgccaag
ttgaatcagagtgggacttcagttggcactgatgaagaatctgatgttactcaagaagaa
gagagagatggacagtactttgaacctgttgttcctttacctgatctagttgaagtatcc
agtggtgaggaaaatgaacaagttgtttttagtcacatggcagaactctacagatatgat
aaagatgttggtcaatggaaagaaaggggcattggtgatataaagattttacagaattat
gataataagcaagttcgtatagtgatgagaagggaccaagtattaaaactttgtgccaat
cacagaataactccagacatgagtttgcaaaatatgaaagggacagaaagagtatgggtg
tggactgcatgtgattttgcagatggagaaagaaaagtagagcatttagctgttcgtttt
aaactacaggatgttgcagactcatttaagaaaatttttgatgaagcaaaaacagcccag
gaaaaagattctttgataacacctcatgtttctcggtcaagcactcccagagagtcacca
tgtggcaaaattgctgtagctgtattagaagaaaccacaagagagaggacagatgttatt
cagggtgatgatgtagcagatgcagcttcagaagttgaagtgtctagcacatctgaaaca
acaacaaaagcagtggtttctcctccaaagtttgtatttggttcagagtctgttaaaaga
atttttagtagtgaaaaatcaaacccatttgcatttggcaacagttctgccactgggtct
ttgtttggatttagttttaatgcacctttgaaaagtaacgatagtgaaactagttcagta
gcccagagtggatctgaaagcaaagtggaacctaaaaaatgtgaactgtcaaagaactct
gatatcgaacagtcttcagatagcaaagtcaaaaatctctctgcttcctttccaatggaa
gaatcttcaatcaactacacatttaaaacaccagaaaaggagcctccattatggcatgct
gaatttaccaaagaagaattggttcagaagctcagttccaccacaaaaagtgcagatcag
ttaaacggcctgcttcgggaaacagaggcaaccagtgcagtccttatggagcaaattaag
cttctcaaaagtgaaataagaagattggaaaggaatcaagaggagtctgcagctaacgtg
gaacacttgaagaacgtcttgctgcagttcattttcttgaagccaggtagtgagagagag
agccttcttcctgttataaatacgatgttgcagctcagccctgaagaaaagggaaaactt
gctgcggttgctcaaggtcttcaagaaacctccatacccaagaaaaaatag

DBGET integrated database retrieval system