KEGG   Homo sapiens (human): 730Help
Entry
730               CDS       T01001                                 

Gene name
C7
Definition
(RefSeq) complement C7
  KO
K03996  complement component 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05322  Systemic lupus erythematosus
Network
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    730 (C7)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    730 (C7)
  09164 Neurodegenerative diseases
   05020 Prion diseases
    730 (C7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF Kazal_3 Sushi TSP_1 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 730
NCBI-ProteinID: NP_000578
OMIM: 217070
HGNC: 1346
Ensembl: ENSG00000112936
Vega: OTTHUMG00000150340
Pharos: P10643(Tbio)
UniProt: P10643 Q05CI3
Structure
PDB: 

Position
5p13.1
AA seq 843 aa AA seqDB search
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgataagcttattcattttggtgggatttataggagagttccaaagtttttca
agtgcctcctctccagtcaactgccagtgggacttctatgccccttggtcagaatgcaat
ggctgtaccaagactcagactcgcaggcggtcagttgctgtgtatgggcagtatggaggc
cagccttgtgttggaaatgcttttgaaacacagtcctgtgaacctacaagaggatgtcca
acagaggagggatgtggagagcgtttcaggtgcttttcaggtcagtgcatcagcaaatca
ttggtttgcaatggggattctgactgtgatgaagacagtgctgatgaagacagatgtgag
gactcagaaaggagaccttcctgtgatatcgataaacctcctcctaacatagaacttact
ggaaatggttacaatgaactcactggccagtttaggaacagagtcatcaataccaaaagt
tttggtggtcaatgtagaaaggtgtttagtggggatggaaaagatttctacaggctgagt
ggaaatgtcctgtcctatacattccaggtgaaaataaataatgattttaattatgaattt
tacaatagtacttggtcttatgtaaaacatacgtcgacagaacacacatcatctagtcgg
aagcgctccttttttagatcttcatcatcttcttcacgcagttatacttcacataccaat
gaaatccataaaggaaagagttaccaactgctggttgttgagaacactgttgaagtggct
cagttcattaataacaatccagaatttttacaacttgctgagccattctggaaggagctt
tcccacctcccctctctgtatgactacagtgcctaccgaagattaatcgaccagtacggg
acacattatctgcaatctgggtcgttaggaggagaatacagagttctattttatgtggac
tcagaaaaattaaaacaaaatgattttaattcagtcgaagaaaagaaatgtaaatcctca
ggttggcattttgtcgttaaattttcaagtcatggatgcaaggaactggaaaacgcttta
aaagctgcttcaggaacccagaacaatgtattgcgaggagaaccgttcatcagaggggga
ggtgcaggcttcatatctggccttagttacctagagctggacaatcctgctggaaacaaa
aggcgatattctgcctgggcagaatctgtgactaatcttcctcaagtcataaaacaaaag
ctgacacctttatatgagctggtaaaggaagtaccttgtgcctctgtgaaaaaactatac
ctgaaatgggctcttgaagagtatctggatgaatttgacccctgtcattgccggccttgt
caaaatggtggtttggctactgttgaggggacccattgtctgtgccattgcaaaccgtac
acatttggtgcggcgtgtgagcaaggagtcctcgtagggaatcaagcaggaggggttgat
ggaggttggagttgctggtcctcttggagcccctgtgtccaagggaagaaaacaagaagc
cgtgaatgcaataacccacctcccagtgggggtgggagatcctgcgttggagaaacgaca
gaaagcacacaatgcgaagatgaggagctggagcacttgaggttgcttgaaccacattgc
tttcctttgtctttggttccaacagaattctgtccatcacctcctgccttgaaagatgga
tttgttcaagatgaaggtacaatgtttcctgtggggaaaaatgtagtgtacacttgcaat
gaaggatactctcttattggaaacccagtggccagatgtggagaagatttacggtggctt
gttggggaaatgcattgtcagaaaattgcctgtgttctacctgtactgatggatggcata
cagagtcacccccaaaaacctttctacacagttggtgagaaggtgactgtttcctgttca
ggtggcatgtccttagaaggtccttcagcatttctctgtggctccagccttaagtggagt
cctgagatgaagaatgcccgctgtgtacaaaaagaaaatccgttaacacaggcagtgcct
aaatgtcagcgctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctacgaa
tgtggaccttccttggatgtatgtgctcaagatgagagaagcaaaaggatactgcctctg
acagtttgcaagatgcatgttctccactgtcagggtagaaattacacccttactggtagg
gacagctgtactctgcctgcctcagctgagaaagcttgtggtgcctgcccactgtgggga
aaatgtgatgctgagagcagcaaatgtgtctgccgagaagcatcggagtgcgaggaagaa
gggtttagcatttgtgtggaagtgaacggcaaggagcagacgatgtctgagtgtgaggcg
ggcgctctgagatgcagagggcagagcatctctgtcaccagcataaggccttgtgctgcg
gaaacccagtag

DBGET integrated database retrieval system