KEGG   Homo sapiens (human): 730094Help
Entry
730094            CDS       T01001                                 

Gene name
MOSMO, ATTHOG, BC030336, C16orf52
Definition
(RefSeq) modulator of smoothened
  KO
K23663  modulator of smoothened protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    730094 (MOSMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atthog L_HMGIC_fpl 7tm_3 Cyt_bd_oxida_I LtrA TctB DUF998 DUF202
Motif
Other DBs
NCBI-GeneID: 730094
NCBI-ProteinID: NP_001158051
HGNC: 27087
Ensembl: ENSG00000185716
Vega: OTTHUMG00000131587
Pharos: Q8NHV5(Tdark)
UniProt: Q8NHV5
Position
16p12.2
AA seq 167 aa AA seqDB search
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggataaactgaccatcatctcaggatgtctctttctggccgccgatatcttcgccatc
gccagcatcgccaacccggactggatcaacaccggggagtctgcgggagcactcactgtg
ggcctcgtgcgacagtgtcaaacaatccatggacgagaccggacgtgcatccctccccgg
cttcccccggagtgggtcaccacactgttttttatcatcatgggaatcatttcattgact
gtcacatgtggtttgctggtggcttcccactggcgaagagaagctacaaaatatgctcga
tggatagcattcactggaatgatccttttctgtatggctgccctaatatttccaatagga
ttttacatcaatgaagtcggaggtcaaccttataaattacccaacaacacagtagttggg
tcatcatatgtactttttgtcttatcaattttctttacaatagtaggacttctatttgct
ggcaaagtttgtttaccaggctga

DBGET integrated database retrieval system