KEGG   Homo sapiens (human): 7305Help
Entry
7305              CDS       T01001                                 

Gene name
TYROBP, DAP12, KARAP, PLOSL, PLOSL1
Definition
(RefSeq) TYRO protein tyrosine kinase binding protein
  KO
K07992  TYRO protein tyrosine kinase binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
Disease
H00438  Nasu-Hakola disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    7305 (TYROBP)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7305 (TYROBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAP10 Syndecan
Motif
Other DBs
NCBI-GeneID: 7305
NCBI-ProteinID: NP_003323
OMIM: 604142
HGNC: 12449
Ensembl: ENSG00000011600
Vega: OTTHUMG00000181739
Pharos: O43914(Tbio)
UniProt: O43914
Structure
PDB: 

Position
19q13.12
AA seq 113 aa AA seqDB search
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALA
VYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggggggacttgaaccctgcagcaggctcctgctcctgcctctcctgctggctgtaagt
ggtctccgtcctgtccaggcccaggcccagagcgattgcagttgctctacggtgagcccg
ggcgtgctggcagggatcgtgatgggagacctggtgctgacagtgctcattgccctggcc
gtgtacttcctgggccggctggtccctcgggggcgaggggctgcggaggcagcgacccgg
aaacagcgtatcactgagaccgagtcgccttatcaggagctccagggtcagaggtcggat
gtctacagcgacctcaacacacagaggccgtattacaaatga

DBGET integrated database retrieval system