KEGG   Homo sapiens (human): 730755Help
Entry
730755            CDS       T01001                                 

Gene name
KRTAP2-3, KAP2.3, KAP2.4, KRTAP2-4, KRTAP2.3, KRTAP2.4
Definition
(RefSeq) keratin associated protein 2-3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2 Keratin_B2_2
Motif
Other DBs
NCBI-GeneID: 730755
NCBI-ProteinID: NP_001158724
HGNC: 18906
Ensembl: ENSG00000212724
Vega: OTTHUMG00000133655
UniProt: P0C7H8 Q9BYR9
Position
17q21.2
AA seq 128 aa AA seqDB search
MTGSCCGSTLSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRR
PVCCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCS
TTCRTSSC
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcctgctgcggctccaccttgtcctccctgagctacgggggaggctgctgc
cagccctgctgctgccgcgacccctgctgctgccgccccgtgacctgccagaccaccgtg
tgccgccccgtgacctgcgtgccccgctgcacgcgccccatctgcgagccctgccgccgc
ccggtgtgctgcgacccctgctccctgcaggaaggctgctgccgccccatcacctgctgc
ccctcgtcgtgcacggctgtggtgtgcaggccctgctgctgggccaccacctgctgccag
cctgtgtctgtgcagtccccctgctgccggcctccctgcggccagccgaccccttgcagc
accacctgcaggacctcctcctgctga

DBGET integrated database retrieval system