KEGG   Homo sapiens (human): 731Help
Entry
731               CDS       T01001                                 

Gene name
C8A
Definition
(RefSeq) complement C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    731 (C8A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    731 (C8A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    731 (C8A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    731 (C8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF Ldl_recept_a TSP_1
Motif
Other DBs
NCBI-GeneID: 731
NCBI-ProteinID: NP_000553
OMIM: 120950
HGNC: 1352
Ensembl: ENSG00000157131
Vega: OTTHUMG00000008306
Pharos: P07357(Tbio)
UniProt: P07357
Structure
PDB: 

Position
1p32.2
AA seq 584 aa AA seqDB search
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgttgttttcttcatcttgtctttgatgacttgtcagcctggggtaactgca
caggagaaggtgaaccagagagtaagacgggcagctacacccgcagcagttacctgccag
ctgagcaactggtcagagtggacagattgctttccgtgccaggacaaaaagtaccgacac
cggagcctcttgcagccaaacaagtttgggggaaccatctgcagtggtgacatctgggat
caagccagctgctccagttctacaacttgtgtaaggcaagcacagtgtggacaggatttc
cagtgtaaggagacaggtcgctgcctgaaacgccaccttgtgtgtaatggagaccaggac
tgccttgatggctctgatgaggacgactgtgaagatgtcagggccattgacgaagactgc
agccagtatgaaccaattccaggatcacagaaggcagccttggggtacaatatcctgacc
caggaagatgctcagagtgtgtacgatgccagttattatgggggccagtgtgagacggta
tacaatggggaatggagggagcttcgatatgactccacctgtgaacgtctctactatgga
gatgatgagaaatactttcggaaaccctacaactttctgaagtaccactttgaagccctg
gcagatactggaatctcctcagagttttatgataatgcaaatgaccttctttccaaagtt
aaaaaagacaagtctgactcatttggagtgaccatcggcataggcccagccggcagccct
ttattggtgggtgtaggtgtatcccactcacaagacacttcattcttgaacgaattaaac
aagtataatgagaagaaattcattttcacaagaatcttcacaaaggtgcagactgcacat
tttaagatgaggaaggatgacattatgctggatgaaggaatgctgcagtcattaatggag
cttccagatcagtacaattatggcatgtatgccaagttcatcaatgactatggcacccat
tacatcacatctggatccatgggtggcatttatgaatatatcctggtgattgacaaagca
aaaatggaatcccttggtattaccagcagagatatcacgacatgttttggaggctccttg
ggcattcaatatgaagacaaaataaatgttggtggaggtttatcaggagaccattgtaaa
aaatttggaggtggcaaaactgaaagggccaggaaggccatggctgtggaagacattatt
tctcgggtgcgaggtggcagttctggctggagcggtggcttggcacagaacaggagcacc
attacataccgttcctgggggaggtcattaaagtataatcctgttgttatcgattttgag
atgcagcctatccacgaggtgctgcggcacacaagcctggggcctctggaggccaagcgc
cagaacctgcgccgcgccttggaccagtatctgatggaattcaatgcctgccgatgtggg
ccttgcttcaacaatggggtgcccatcctcgagggcaccagctgcaggtgccagtgccgc
ctgggtagcttgggtgctgcctgtgagcaaacacagacagaaggagccaaagcagatggg
agctggagttgctggagctcctggtctgtatgcagagcaggcatccaggaaaggagaaga
gagtgtgacaatccagcacctcagaatggaggggcctcgtgtccagggcggaaagtacag
acgcaggcttgctga

KEGG   Homo sapiens (human): 732Help
Entry
732               CDS       T01001                                 

Gene name
C8B, C82
Definition
(RefSeq) complement C8 beta chain
  KO
K03998  complement component 8 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    732 (C8B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    732 (C8B)
  09164 Neurodegenerative disease
   05020 Prion diseases
    732 (C8B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    732 (C8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF Ldl_recept_a TSP_1
Motif
Other DBs
NCBI-GeneID: 732
NCBI-ProteinID: NP_000057
OMIM: 120960
HGNC: 1353
Ensembl: ENSG00000021852
Vega: OTTHUMG00000008305
Pharos: P07358(Tbio)
UniProt: P07358
Structure
PDB: 

Position
1p32.2
AA seq 591 aa AA seqDB search
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattccaggacatgggcttggagggcgccggtggagctatttcttctctgtgct
gccctgggctgtctcagtttgcctggctccagaggtgaaaggccacattcctttgggtca
aatgcagtcaacaagagctttgctaagagcagacagatgcggagtgtggatgttaccctg
atgcccattgattgtgagctgtctagttggtcctcttggaccacatgtgacccctgtcag
aagaaaaggtacaggtatgcctacttgctccagccctctcagttccatggggaaccgtgc
aacttctctgacaaggaagtcgaagactgtgttaccaacagaccatgcggaagtcaagtg
cgatgtgaaggctttgtgtgtgcacagacaggaaggtgtgtaaaccgcagacttctttgc
aatggggacaatgactgtggagaccagtcagatgaagcaaactgtagaaggatttataaa
aaatgtcagcatgaaatggaccaatactggggaattggcagtctggccagtgggataaat
ttgttcacaaacagttttgagggcccagttcttgatcacaggtattatgcaggtggatgc
tccccgcattacatcctgaacacgaggtttaggaagccctacaatgtggaaagctacacg
ccacagacccaaggcaaatacgaattcatattaaaagagtatgaatcatactcagatttt
gaacgcaatgtcacagagaaaatggcaagcaagtctggtttcagttttggttttaaaata
cctggaatatttgaacttggcatcagtagtcaaagtgatcgaggcaaacactatattagg
agaaccaaacgattctctcatactaaaagcgtatttctgcatgcacgctctgaccttgaa
gtagcacattacaagctgaaacccagaagcctcatgctccattacgagttccttcagaga
gttaagcggctgcccctggagtacagctacggggaatacagagatctcttccgtgatttt
gggacccactacatcacagaggctgtgcttgggggcatttatgaatacaccctcgttatg
aacaaagaggccatggagagaggagattatactcttaacaacgtccatgcctgtgccaaa
aatgattttaaaattggtggtgccattgaagaggtctacgtcagtctgggtgtgtctgta
ggcaaatgcagaggtattctgaatgaaataaaagacagaaacaagagggacaccatggtg
gaggacttggtggtcctggtacgaggaggggcaagtgagcacatcaccaccctggcatac
caggagctgccgacggcggacctgatgcaggagtggggagacgctgtgcagtacaaccca
gccatcatcaaagttaaggtggagcctctgtatgaactagtgacagccacagattttgcc
tattccagcacagtgaggcagaacatgaagcaggcactggaggagttccagaaggaagtt
agttcctgccactgtgctccctgccaaggaaatggagtccctgtcctgaaaggatcacgc
tgtgactgcatctgtcctgttggatcccaaggcctagcctgtgaggtctcctatcggaag
aatacccccattgatgggaagtggaattgctggtcaaattggtcttcatgctctggaaga
cgtaagacaagacaaaggcagtgtaacaatccacctcctcaaaatgggggtagcccctgt
tcaggccctgcttcagaaacacttgactgctcctag

KEGG   Homo sapiens (human): 733Help
Entry
733               CDS       T01001                                 

Gene name
C8G, C8C
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00463  Alternative pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    733 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    733 (C8G)
  09164 Neurodegenerative disease
   05020 Prion diseases
    733 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    733 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 733
NCBI-ProteinID: NP_000597
OMIM: 120930
HGNC: 1354
Ensembl: ENSG00000176919
Vega: OTTHUMG00000020955
Pharos: P07360(Tbio)
UniProt: P07360
Structure
PDB: 

Position
9q34.3
AA seq 202 aa AA seqDB search
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccctgggactgcgaccctcttgactctgctcctggcagctggctcgctgggc
cagaagcctcagaggccacgccggcccgcatcccccatcagcaccatccagcccaaggcc
aattttgatgctcagcagtttgcagggacctggctccttgtggctgtgggctccgcttgc
cgtttcctgcaggagcagggccaccgggccgaggccaccacactgcatgtggctccccag
ggcacagccatggctgtcagtaccttccgaaagctggatgggatctgctggcaggtgcgc
cagctctatggagacacaggggtcctcggccgcttcctgcttcaagcccgagacgcccga
ggggctgtgcacgtggttgtcgctgagaccgactaccagagtttcgctgtcctgtacctg
gagcgggcggggcagctgtcagtgaagctctacgcccgctcgctccctgtgagcgactcg
gtcctgagtgggtttgagcagcgggtccaggaggcccacctgactgaggaccagatcttc
tacttccccaagtacggcttctgcgaggctgcagaccagttccacgtcctggacgaagtg
aggaggtga

DBGET integrated database retrieval system