KEGG   Homo sapiens (human): 7311
Entry
7311              CDS       T01001                                 
Symbol
UBA52, CEP52, HUBCEP52, L40, RPL40
Name
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01317  Translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    7311 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7311 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7311 (UBA52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    7311 (UBA52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7311 (UBA52)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7311 (UBA52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7311 (UBA52)
   05022 Pathways of neurodegeneration - multiple diseases
    7311 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    7311 (UBA52)
   04121 Ubiquitin system [BR:hsa04121]
    7311 (UBA52)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    7311 (UBA52)
  Archaea
    7311 (UBA52)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7311 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 7311
NCBI-ProteinID: NP_001029102
OMIM: 191321
HGNC: 12458
Ensembl: ENSG00000221983
Pharos: P62987(Tbio)
UniProt: P62987 Q3MIH3 Q7Z4P3
Structure
Position
19:18563766..18577550
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctcactggcaaaaccatcacccttgaggtcgagcccagt
gacaccattgagaatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag
cagcgtctgatatttgccggcaaacagctggaggatggccgcactctctcagactacaac
atccagaaagagtccaccctgcacctggtgttgcgcctgcgaggtggcattattgagcct
tctctccgccagcttgcccagaaatacaactgcgacaagatgatctgccgcaagtgctat
gctcgccttcaccctcgtgctgtcaactgccgcaagaagaagtgtggtcacaccaacaac
ctgcgtcccaagaagaaggtcaaataa

DBGET integrated database retrieval system