KEGG   Homo sapiens (human): 7319Help
Entry
7319              CDS       T01001                                 

Gene name
UBE2A, HHR6A, MRXS30, MRXSN, RAD6A, UBC2
Definition
(RefSeq) ubiquitin conjugating enzyme E2 A
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7319 (UBE2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7319 (UBE2A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7319 (UBE2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7319 (UBE2A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7319 (UBE2A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7319 (UBE2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV DUF5487
Motif
Other DBs
NCBI-GeneID: 7319
NCBI-ProteinID: NP_003327
OMIM: 312180
HGNC: 12472
Ensembl: ENSG00000077721
Vega: OTTHUMG00000022275
Pharos: P49459(Tbio)
UniProt: P49459
Structure
PDB: 

Position
Xq24
AA seq 152 aa AA seqDB search
MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFT
EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWRDC
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccggctcggcggcgcctcatgcgggacttcaagaggttgcaggaggatcct
ccagccggagtcagcggggctccgtccgagaacaacataatggtgtggaacgcggtcatt
ttcgggcctgaagggaccccgtttgaggatggaacatttaaacttacaatagaattcact
gaagaatatccaaataaaccacctacagttagatttgtctctaagatgttccatccaaat
gtctatgcagatggtagtatatgtctggacatacttcagaaccgttggagtccaacctat
gatgtgtcttccattctaacatccatacagtctctgttggatgaacccaatcccaatagt
ccagcaaacagccaggctgctcagctgtaccaggagaacaaacgggaatatgaaaagcgt
gtttctgcaatagtagaacaaagctggcgtgattgttga

DBGET integrated database retrieval system