KEGG   Homo sapiens (human): 7321
Entry
7321              CDS       T01001                                 

Gene name
UBE2D1, E2(17)KB1, SFT, UBC4/5, UBCH5, UBCH5A
Definition
(RefSeq) ubiquitin conjugating enzyme E2 D1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7321 (UBE2D1)
   04120 Ubiquitin mediated proteolysis
    7321 (UBE2D1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7321 (UBE2D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7321 (UBE2D1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7321 (UBE2D1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7321 (UBE2D1)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 7321
NCBI-ProteinID: NP_003329
OMIM: 602961
HGNC: 12474
Ensembl: ENSG00000072401
Vega: OTTHUMG00000018269
Pharos: P51668(Tbio)
UniProt: P51668 A0A024QZJ2
Structure
PDB: 

Position
10q21.1
AA seq 147 aa
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaagaggattcagaaagaattgagtgatctacagcgcgatccacctgctcac
tgttcagctggacctgtgggagatgacttgttccactggcaagccactattatggggcct
cctgatagcgcatatcaaggtggagtcttctttctcactgtacattttccgacagattat
ccttttaaaccaccaaagattgctttcacaacaaaaatttaccatccaaacataaacagt
aatggaagtatttgtctcgatattctgaggtcacaatggtcaccagctctgactgtatca
aaagttttattgtccatatgttctctactttgtgatcctaatccagatgaccccttagta
ccagatattgcacaaatctataaatcagacaaagaaaaatacaacagacatgcaagagaa
tggactcagaaatatgcaatgtaa

DBGET integrated database retrieval system