KEGG   Homo sapiens (human): 7325Help
Entry
7325              CDS       T01001                                 

Gene name
UBE2E2, UBCH8
Definition
(RefSeq) ubiquitin conjugating enzyme E2 E2
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7325 (UBE2E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7325 (UBE2E2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7325 (UBE2E2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7325 (UBE2E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD
Motif
Other DBs
NCBI-GeneID: 7325
NCBI-ProteinID: NP_689866
OMIM: 602163
HGNC: 12478
Ensembl: ENSG00000182247
Vega: OTTHUMG00000130482
Pharos: Q96LR5(Tbio)
UniProt: Q96LR5 A0A024R2Q2
Structure
PDB: 

Position
3p24.3
AA seq 201 aa AA seqDB search
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YMTNRAEHDRMARQWTKRYAT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaggcacaaagagttgatgacagtccaagcactagtggaggaagttccgat
ggagatcaacgtgaaagtgttcagcaagaaccagaaagagaacaagttcagcccaagaaa
aaggagggaaaaatatccagcaaaaccgctgctaaattgtcaactagtgctaaaagaatt
cagaaggaacttgcagaaatcacattggaccctcctcccaactgtagtgctggacccaaa
ggagacaacatttatgaatggaggtcaactatattgggacccccaggatctgtctatgaa
ggaggggtgttctttcttgacattaccttttcaccagactatccgtttaaaccccctaag
gttaccttccgaacaagaatctatcactgtaatattaacagccaaggtgtgatctgtctg
gacatcttaaaggacaactggagtccggctttaactatttctaaagttctcctctccatc
tgctcacttcttacagattgcaaccctgctgaccctctggtgggcagcatcgccacacag
tacatgaccaacagagcagagcatgaccggatggccagacagtggaccaagcggtacgcc
acatag

DBGET integrated database retrieval system