KEGG   Homo sapiens (human): 7326Help
Entry
7326              CDS       T01001                                 

Gene name
UBE2G1, E217K, UBC7, UBE2G
Definition
(RefSeq) ubiquitin conjugating enzyme E2 G1
  KO
K10575  ubiquitin-conjugating enzyme E2 G1 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7326 (UBE2G1)
   04120 Ubiquitin mediated proteolysis
    7326 (UBE2G1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7326 (UBE2G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7326 (UBE2G1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7326 (UBE2G1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7326 (UBE2G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD
Motif
Other DBs
NCBI-GeneID: 7326
NCBI-ProteinID: NP_003333
OMIM: 601569
HGNC: 12482
Ensembl: ENSG00000132388
Vega: OTTHUMG00000177826
Pharos: P62253(Tbio)
UniProt: P62253
Structure
PDB: 

Position
17p13.2
AA seq 170 aa AA seqDB search
MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLT
FPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETI
MISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctgcagtcggcactgctactgcgaagacagctggcagaactcaacaaaaat
ccagtggaaggcttttctgcaggtttaatagatgacaatgatctctaccgatgggaagtc
cttattattggccctccagatacactttatgaaggtggtgtttttaaggctcatcttact
ttcccaaaagattatcccctccgacctcctaaaatgaaattcattacagaaatctggcac
ccaaatgttgataaaaatggtgatgtgtgcatttctattcttcatgagcctggggaagat
aagtatggttatgaaaagccagaggaacgctggctccctatccacactgtggaaaccatc
atgattagtgtcatttctatgctggcagaccctaatggagactcacctgctaatgttgat
gctgcgaaagaatggagggaagatagaaatggagaatttaaaagaaaagttgcccgctgt
gtaagaaaaagccaagagactgcttttgagtga

DBGET integrated database retrieval system