KEGG   Homo sapiens (human): 7327
Entry
7327              CDS       T01001                                 

Symbol
UBE2G2, UBC7
Name
(RefSeq) ubiquitin conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7327 (UBE2G2)
   04120 Ubiquitin mediated proteolysis
    7327 (UBE2G2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7327 (UBE2G2)
   05022 Pathways of neurodegeneration - multiple diseases
    7327 (UBE2G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7327 (UBE2G2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7327 (UBE2G2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7327 (UBE2G2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 7327
NCBI-ProteinID: NP_003334
OMIM: 603124
HGNC: 12483
Ensembl: ENSG00000184787
Vega: OTTHUMG00000089179
Pharos: P60604(Tbio)
UniProt: P60604
Structure
PDB: 
3H8K 4LAD 2CYX 2LXP 2KLY

Position
21q22.3
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggggaccgcgctcaagaggctgatggccgagtacaaacaattaacactgaatcct
ccggaaggaattgtagcaggccccatgaatgaagagaacttttttgaatgggaggcattg
atcatgggcccagaagacacctgctttgagtttggtgtttttcctgccatcctgagtttc
ccacttgattacccgttaagtcccccaaagatgagatttacctgtgagatgtttcatccc
aacatctaccctgatgggagagtctgcatttccatcctccacgcgccaggcgatgacccc
atgggctacgagagcagcgcggagcggtggagtcctgtgcagagtgtggagaagatcctg
ctgtcggtggtgagcatgctggcagagcccaatgacgaaagtggagctaacgtggatgcg
tccaaaatgtggcgcgatgaccgggagcagttctataagattgccaagcagatcgtccag
aagtctctgggactgtga

DBGET integrated database retrieval system