KEGG   Homo sapiens (human): 733Help
Entry
733               CDS       T01001                                 

Gene name
C8G, C8C
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    733 (C8G)
 09160 Human Diseases
  09162 Immune diseases
   05322 Systemic lupus erythematosus
    733 (C8G)
  09163 Neurodegenerative diseases
   05020 Prion diseases
    733 (C8G)
  09167 Infectious diseases
   05146 Amoebiasis
    733 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 733
NCBI-ProteinID: NP_000597
OMIM: 120930
HGNC: 1354
Ensembl: ENSG00000176919
Vega: OTTHUMG00000020955
Pharos: P07360(Tbio)
UniProt: P07360
Structure
PDB: 

Position
9q34.3
AA seq 202 aa AA seqDB search
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccctgggactgcgaccctcttgactctgctcctggcagctggctcgctgggc
cagaagcctcagaggccacgccggcccgcatcccccatcagcaccatccagcccaaggcc
aattttgatgctcagcagtttgcagggacctggctccttgtggctgtgggctccgcttgc
cgtttcctgcaggagcagggccaccgggccgaggccaccacactgcatgtggctccccag
ggcacagccatggctgtcagtaccttccgaaagctggatgggatctgctggcaggtgcgc
cagctctatggagacacaggggtcctcggccgcttcctgcttcaagcccgagacgcccga
ggggctgtgcacgtggttgtcgctgagaccgactaccagagtttcgctgtcctgtacctg
gagcgggcggggcagctgtcagtgaagctctacgcccgctcgctccctgtgagcgactcg
gtcctgagtgggtttgagcagcgggtccaggaggcccacctgactgaggaccagatcttc
tacttccccaagtacggcttctgcgaggctgcagaccagttccacgtcctggacgaagtg
aggaggtga

DBGET integrated database retrieval system