KEGG   Homo sapiens (human): 7334Help
Entry
7334              CDS       T01001                                 

Gene name
UBE2N, HEL-S-71, UBC13, UBCHBEN, UbcH-ben, UbcH13
Definition
(RefSeq) ubiquitin conjugating enzyme E2 N
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7334 (UBE2N)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7334 (UBE2N)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7334 (UBE2N)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7334 (UBE2N)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7334 (UBE2N)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7334 (UBE2N)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B UEV RWD
Motif
Other DBs
NCBI-GeneID: 7334
NCBI-ProteinID: NP_003339
OMIM: 603679
HGNC: 12492
Ensembl: ENSG00000177889
Vega: OTTHUMG00000170156
Pharos: P61088(Tbio)
UniProt: P61088 V9HW41
Structure
PDB: 

Position
12q22
AA seq 152 aa AA seqDB search
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctgccccgcaggatcatcaaggaaacccagcgtttgctggcagaaccagtt
cctggcatcaaagccgaaccagatgagagcaacgcccgttattttcatgtggtcattgct
ggccctcaggattccccctttgagggagggacttttaaacttgaactattccttccagaa
gaatacccaatggcagcccctaaagtacgtttcatgaccaaaatttatcatcctaatgta
gacaagttgggaagaatatgtttagatattttgaaagataagtggtccccagcactgcag
atccgcacagttctgctatcgatccaggccttgttaagtgctcccaatccagatgatcca
ttagcaaatgatgtagcggagcagtggaagaccaacgaagcccaagccatagaaacagct
agagcatggactaggctatatgccatgaataatatttaa

DBGET integrated database retrieval system