KEGG   Homo sapiens (human): 7335
Entry
7335              CDS       T01001                                 

Gene name
UBE2V1, CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A
Definition
(RefSeq) ubiquitin conjugating enzyme E2 V1
  KO
K10704  ubiquitin-conjugating enzyme E2 variant
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7335 (UBE2V1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7335 (UBE2V1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7335 (UBE2V1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 7335
NCBI-ProteinID: NP_001027459
OMIM: 602995
HGNC: 12494
Ensembl: ENSG00000244687
Vega: OTTHUMG00000152626
Pharos: Q13404(Tbio)
UniProt: Q13404
Structure
PDB: 
2HLW

Position
20q13.13
AA seq 147 aa
MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIY
ENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVV
LQELRRLMMSKENMKLPQPPEGQCYSN
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcagccaccacgggctcgggagtaaaagtccctcgcaatttccgactgttggaagaa
ctcgaagaaggccagaaaggagtaggagatggcacagttagctggggtctagaagatgac
gaagacatgacacttacaagatggacagggatgataattgggcctccaagaacaatttat
gaaaaccgaatatacagccttaaaatagaatgtggacctaaatacccagaagcacccccc
tttgtaagatttgtaacaaaaattaatatgaatggagtaaatagttctaatggagtggtg
gacccaagagccatatcagtgctagcaaaatggcagaattcatatagcatcaaagttgtc
ctgcaagagcttcggcgcctaatgatgtctaaagaaaatatgaaactccctcagccgccc
gaaggacagtgttacagcaattaa

DBGET integrated database retrieval system