KEGG   Homo sapiens (human): 7336
Entry
7336              CDS       T01001                                 

Gene name
UBE2V2, DDVIT1, DDVit-1, EDAF-1, EDPF-1, EDPF1, MMS2, UEV-2, UEV2
Definition
(RefSeq) ubiquitin conjugating enzyme E2 V2
  KO
K10704  ubiquitin-conjugating enzyme E2 variant
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7336 (UBE2V2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7336 (UBE2V2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7336 (UBE2V2)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 7336
NCBI-ProteinID: NP_003341
OMIM: 603001
HGNC: 12495
Ensembl: ENSG00000169139
Vega: OTTHUMG00000164206
Pharos: Q15819(Tbio)
UniProt: Q15819 A0M8W4
Structure
PDB: 

Position
8q11.21
AA seq 145 aa
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcggtctccacaggagttaaagttcctcgtaattttcgcttgttggaagaacttgaa
gaaggacaaaaaggagtaggcgacggtacagttagctggggccttgaagatgatgaagat
atgacacttacaaggtggacaggcatgattattgggccaccaaggacaaattatgaaaac
agaatatatagcctgaaagtagaatgtggacctaaatacccagaagctcctccgtcagtt
agatttgtaacaaaaattaatatgaacggaataaataattccagtgggatggtggatgcc
cggagcataccagtgttagcaaaatggcaaaattcatatagcattaaagttgtacttcaa
gagctaagacgtctaatgatgtccaaagaaaatatgaagcttccacagccaccagaagga
caaacatacaacaattaa

DBGET integrated database retrieval system