KEGG   Homo sapiens (human): 7337Help
Entry
7337              CDS       T01001                                 

Gene name
UBE3A, ANCR, AS, E6-AP, EPVE6AP, HPVE6A
Definition
(RefSeq) ubiquitin protein ligase E3A
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
N00343  HPV E6 to MAGI-PTEN signaling pathway
N00345  HPV E6 to CRB3-Pals1-PATJ complex
N00357  HPV E6 to PI3K signaling pathway
N00358  HPV E6 to p21-cell cycle G1/S
N00373  HPV E6 to NFX1-mediated transcription
N00383  HPV E6 to intrinsic apoptotic pathway
Disease
H01732  Angelman syndrome (AS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7337 (UBE3A)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    7337 (UBE3A)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    7337 (UBE3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7337 (UBE3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     7337 (UBE3A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   7337 (UBE3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT AZUL PCM1_C Ribosomal_S17e
Motif
Other DBs
NCBI-GeneID: 7337
NCBI-ProteinID: NP_000453
OMIM: 601623
HGNC: 12496
Ensembl: ENSG00000114062
Vega: OTTHUMG00000171548
Pharos: Q05086(Tbio)
UniProt: Q05086
Structure
PDB: 

Position
15q11.2
AA seq 875 aa AA seqDB search
MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTF
LRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARI
DFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKS
LQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIR
RVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE
YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRN
LVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK
KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTC
PFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRL
EMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW
FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQ
SLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDY
ILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGY
TRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS
HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgcaccagtgttattggaaatcaggagaacctcagtctgacgacattgaa
gctagccgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccaccagtta
actgagggctgtggaaatgaagcctgcacgaatgagttttgtgcttcctgtccaactttt
cttcgtatggataataatgcagcagctattaaagccctcgagctttataagattaatgca
aaactctgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcg
aaaggtgcccccaacaactcctgctctgagataaaaatgaacaagaaaggcgctagaatt
gattttaaagatgtgacttacttaacagaagagaaggtatatgaaattcttgaattatgt
agagaaagagaggattattcccctttaatccgtgttattggaagagttttttctagtgct
gaggcattggtacagagcttccggaaagttaaacaacacaccaaggaagaactgaaatct
cttcaagcaaaagatgaagacaaagatgaagatgaaaaggaaaaagctgcatgttctgct
gctgctatggaagaagactcagaagcatcttcctcaaggataggtgatagctcacaggga
gacaacaatttgcaaaaattaggccctgatgatgtgtctgtggatattgatgccattaga
agggtctacaccagattgctctctaatgaaaaaattgaaactgcctttctcaatgcactt
gtatatttgtcacctaacgtggaatgtgacttgacgtatcacaatgtatactctcgagat
cctaattatctgaatttgttcattatcgtaatggagaatagaaatctccacagtcctgaa
tatctggaaatggctttgccattattttgcaaagcgatgagcaagctaccccttgcagcc
caaggaaaactgatcagactgtggtctaaatacaatgcagaccagattcggagaatgatg
gagacatttcagcaacttattacttataaagtcataagcaatgaatttaacagtcgaaat
ctagtgaatgatgatgatgccattgttgctgcttcgaagtgcttgaaaatggtttactat
gcaaatgtagtgggaggggaagtggacacaaatcacaatgaagaagatgatgaagagccc
atccctgagtccagcgagctgacacttcaggaacttttgggagaagaaagaagaaacaag
aaaggtcctcgagtggaccccctggaaactgaacttggtgttaaaaccctggattgtcga
aaaccacttatcccttttgaagagtttattaatgaaccactgaatgaggttctagaaatg
gataaagattatacttttttcaaagtagaaacagagaacaaattctcttttatgacatgt
ccctttatattgaatgctgtcacaaagaatttgggattatattatgacaatagaattcgc
atgtacagtgaacgaagaatcactgttctctacagcttagttcaaggacagcagttgaat
ccatatttgagactcaaagttagacgtgaccatatcatagatgatgcacttgtccggcta
gagatgatcgctatggaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaa
ggagaacaaggagttgatgagggaggtgtttccaaagaattttttcagctggttgtggag
gaaatcttcaatccagatattggtatgttcacatacgatgaatctacaaaattgttttgg
tttaatccatcttcttttgaaactgagggtcagtttactctgattggcatagtactgggt
ctggctatttacaataactgtatactggatgtacattttcccatggttgtctacaggaag
ctaatggggaaaaaaggaacttttcgtgacttgggagactctcacccagttctatatcag
agtttaaaagatttattggagtatgaagggaatgtggaagatgacatgatgatcactttc
cagatatcacagacagatctttttggtaacccaatgatgtatgatctaaaggaaaatggt
gataaaattccaattacaaatgaaaacaggaaggaatttgtcaatctttattctgactac
attctcaataaatcagtagaaaaacagttcaaggcttttcggagaggttttcatatggtg
accaatgaatctcccttaaagtacttattcagaccagaagaaattgaattgcttatatgt
ggaagccggaatctagatttccaagcactagaagaaactacagaatatgacggtggctat
accagggactctgttctgattagggagttctgggaaatcgttcattcatttacagatgaa
cagaaaagactcttcttgcagtttacaacgggcacagacagagcacctgtgggaggacta
ggaaaattaaagatgattatagccaaaaatggcccagacacagaaaggttacctacatct
catacttgctttaatgtgcttttacttccggaatactcaagcaaagaaaaacttaaagag
agattgttgaaggccatcacgtatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system