KEGG   Homo sapiens (human): 7341Help
Entry
7341              CDS       T01001                                 

Gene name
SUMO1, DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
Definition
(RefSeq) small ubiquitin-like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00427  Nuclear pore complex
Disease
H00516  Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    7341 (SUMO1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7341 (SUMO1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     7341 (SUMO1)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   7341 (SUMO1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    7341 (SUMO1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    7341 (SUMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 7341
NCBI-ProteinID: NP_001005781
OMIM: 601912
HGNC: 12502
Ensembl: ENSG00000116030
Vega: OTTHUMG00000132839
Pharos: P63165(Tbio)
UniProt: P63165 A0A024R3Z2
Structure
PDB: 

Position
2q33.1
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttgggggataagaaggaaggtgaa
tatattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggtgttccaatgaat
tcactcaggtttctctttgagggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcattcaaca
gtttag

DBGET integrated database retrieval system