KEGG   Homo sapiens (human): 7343
Entry
7343              CDS       T01001                                 

Gene name
UBTF, CONDBA, NOR-90, UBF, UBF-1, UBF1, UBF2
Definition
(RefSeq) upstream binding transcription factor
  KO
K09273  upstream-binding transcription factor
Organism
hsa  Homo sapiens (human)
Disease
H02476  Childhood-onset neurodegeneration with brain atrophy
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   UBF
    7343 (UBTF)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    UBF
     7343 (UBTF)
SSDB
Motif
Pfam: HMG_box_5 HMG_box HMG_box_2 DUF4473 Chlor_dismutase
Other DBs
NCBI-GeneID: 7343
NCBI-ProteinID: NP_055048
OMIM: 600673
HGNC: 12511
Ensembl: ENSG00000108312
Vega: OTTHUMG00000167585
Pharos: P17480(Tbio)
UniProt: P17480
Structure
PDB: 
2HDZ 1L8Y 1L8Z 1K99

Position
17q21.31
AA seq 764 aa
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDK
KRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKP
PPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLR
FLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEE
KRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGK
LPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKR
YERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI
GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLR
GPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESED
GDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgaacggagaagccgactgccccacagacctggaaatggccgcccccaaaggccaagac
cgttggtcccaggaagacatgctgactttgctggaatgcatgaagaacaaccttccatcc
aatgacagctccaagttcaaaaccaccgaatcacacatggactgggaaaaagtagcattt
aaagacttttctggagacatgtgcaagctcaaatgggtggagatttctaatgaggtgagg
aagttccgtacattgacagaattgatcctcgatgctcaggaacatgttaaaaatccttac
aaaggcaaaaaactcaagaaacacccagacttcccaaagaagcccctgaccccttatttc
cgcttcttcatggagaagcgggccaagtatgcgaaactccaccctgagatgagcaacctg
gacctaaccaagattctgtccaagaaatacaaggagcttccggagaagaagaagatgaaa
tatattcaggacttccagagagagaaacaggagttcgagcgaaacctggcccgattcagg
gaggatcaccccgacctaatccagaatgccaagaaatcggacatcccagagaagcccaaa
accccccagcagctgtggtacacccacgagaagaaggtgtatctcaaagtgcggccagat
gccactacgaaggaggtgaaggactccctggggaagcagtggtctcagctctcggacaaa
aagaggctgaaatggattcataaggccctggagcagcggaaggagtacgaggagatcatg
agagactatatccagaagcacccagagctgaacatcagtgaggagggtatcaccaagtcc
accctcaccaaggccgaacgccagctcaaggacaagtttgacgggcgacccaccaagcca
cctccgaacagctactcgctgtactgcgcagagctcatggccaacatgaaggacgtgccc
agcacagagcgcatggtgctgtgcagccagcagtggaagctgctgtcccagaaggagaag
gacgcctatcacaagaagtgtgatcagaaaaagaaagattacgaggtggagctgctccgt
ttcctcgagagcctgcctgaggaggagcagcagcgggtcttgggggaagagaagatgctg
aacatcaacaagaagcaggccaccagccccgcctccaagaagccagcccaggaagggggc
aagggcggctccgagaagcccaagcggcccgtgtcggccatgttcatcttctcggaggag
aaacggcggcagctgcaggaggagcggcctgagctctccgagagcgagctgacccgcctg
ctggcccgaatgtggaacgacctgtctgagaagaagaaggccaagtacaaggcccgagag
gcggcgctcaaggctcagtcggagaggaagcccggcggggagcgcgaggaacggggcaag
ctgcccgagtcccccaaaagagctgaggagatctggcaacagagcgttatcggcgactac
ctggcccgcttcaagaatgaccgggtgaaggccttgaaagccatggaaatgacctggaat
aacatggaaaagaaggagaaactgatgtggattaagaaggcagccgaagaccaaaagcga
tatgagagagagctgagtgagatgcgggcacctccagctgctacaaattcttccaagaag
atgaaattccagggagaacccaagaagcctcccatgaacggttaccagaagttctcccag
gagctgctgtccaatggggagctgaaccacctgccgctgaaggagcgcatggtggagatc
ggcagtcgctggcagcgcatctcccagagccagaaggagcactacaaaaagctggccgag
gagcagcaaaagcagtacaaggtgcacctggacctctgggttaagagcctgtctccccag
gaccgtgcagcatataaagagtacatctccaataaacgtaagagcatgaccaagctgcga
ggcccaaaccccaaatccagccggactactctgcagtccaagtcggagtccgaggaggat
gatgaagaggatgaggatgacgaggacgaggatgaagaagaggaagatgatgagaatggg
gactcctctgaagatggcggcgactcctctgagtccagcagcgaggacgagagcgaggat
ggggatgagaatgaagaggatgacgaggacgaagacgacgacgaggatgacgatgaggat
gaagataatgagtccgagggcagcagctccagctcctcctcctcaggggactcctcagac
tctgactccaactga

DBGET integrated database retrieval system