KEGG   Homo sapiens (human): 7350Help
Entry
7350              CDS       T01001                                 

Gene name
UCP1, SLC25A7, UCP
Definition
(RefSeq) uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04371  Apelin signaling pathway
hsa04714  Thermogenesis
hsa05016  Huntington disease
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    7350 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    7350 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7350 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    7350 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7350 (UCP1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   7350 (UCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Utp8
Motif
Other DBs
NCBI-GeneID: 7350
NCBI-ProteinID: NP_068605
OMIM: 113730
HGNC: 12517
Ensembl: ENSG00000109424
Vega: OTTHUMG00000133415
Pharos: P25874(Tbio)
UniProt: P25874
Position
4q31.1
AA seq 307 aa AA seqDB search
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggggggcctgacagcctcggacgtacacccgaccctgggggtccagctcttctcagct
ggaatagcggcgtgcttggcggacgtgatcaccttcccgctggacacggccaaagtccgg
ctccaggtccaaggtgaatgcccgacgtccagtgttattaggtataaaggtgtcctggga
acaatcaccgctgtggtaaaaacagaagggcggatgaaactctacagcgggctgcctgcg
gggcttcagcggcaaatcagctccgcctctctcaggatcggcctctacgacacggtccag
gagttcctcaccgcagggaaagaaacagcacctagtttaggaagcaagattttagctggt
ctaacgactggaggagtggcagtattcattgggcaacccacagaggtcgtgaaagtcaga
cttcaagcacagagccatctccacggaatcaaacctcgctacacggggacttataatgcg
tacagaataatagcaacaaccgaaggcttgacgggtctttggaaagggactactcccaat
ctgatgagaagtgtcatcatcaattgtacagagctagtaacatatgatctaatgaaggag
gcctttgtgaaaaacaacatattagcagatgacgtcccctgccacttggtgtcggctctt
atcgctggattttgcgcaacagctatgtcctccccggtggatgtagtaaaaaccagattt
attaattctccaccaggacagtacaaaagtgtgcccaactgtgcaatgaaagtgttcact
aacgaaggaccaacggctttcttcaaggggttggtaccttccttcttgcgacttggatcc
tggaacgtcattatgtttgtgtgctttgaacaactgaaacgagaactgtcaaagtcaagg
cagactatggactgtgccacataa

DBGET integrated database retrieval system